y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00044843m
FamilyCBM43
Protein PropertiesLength: 454 Molecular Weight: 47375.4 Isoelectric Point: 7.1497
ChromosomeChromosome/Scaffold: 025806 Start: 1549 End: 3250
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17491433.4e-29
  LGVNYGTVADDLPSAARSVQLLRAAGAGAVKIYDANPGILRALAGTGLPVAIMVPNAAIPSLASSRAAAEDWVAANLAPHSPATRVMYLLVGNEV
CBM433604478.8e-31
  WCVLAAGGGKAADGKAVQDALDYACQQGSGTCDAIQPGGACHEPDTLDAHASYAFNSYWQQFRNRGGTCSFNGLAETTTKDPSYGSCK
GH171433350
  VKLSTTLAMGALSASYPPSAGAFRDDVAGDVIRPLLRFLKATRSFYFVDAYPYFAWAANRDAISLDYALFQGAASSHYVDPGTGHTYTNLLDQMLDAVVA
  AMGKLGYGDVKLAVAETGWPSAGGAGANVRNAATYNRNLAARMSKNPGTPARPGAKMPVFLFSLYNEDQKPGAGTERHWWLYYPNQTKVYEID
Full Sequence
Protein Sequence     Length: 454     Download
MAGATVAPSS SHRAVVVLLL AAALACHLNI VAVAVKPECS CPGGKCRGLG VNYGTVADDL    60
PSAARSVQLL RAAGAGAVKI YDANPGILRA LAGTGLPVAI MVPNAAIPSL ASSRAAAEDW    120
VAANLAPHSP ATRVMYLLVG NEVKLSTTLA MGALSASYPP SAGAFRDDVA GDVIRPLLRF    180
LKATRSFYFV DAYPYFAWAA NRDAISLDYA LFQGAASSHY VDPGTGHTYT NLLDQMLDAV    240
VAAMGKLGYG DVKLAVAETG WPSAGGAGAN VRNAATYNRN LAARMSKNPG TPARPGAKMP    300
VFLFSLYNED QKPGAGTERH WWLYYPNQTK VYEIDLTGQR SSRSYPPLPP ADDTDSSAAW    360
CVLAAGGGKA ADGKAVQDAL DYACQQGSGT CDAIQPGGAC HEPDTLDAHA SYAFNSYWQQ    420
FRNRGGTCSF NGLAETTTKD PSYGSCKFLS SED*                                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X83.0e-1436043480+
smart00768X84.0e-3236044889+
pfam00332Glyco_hydro_171.0e-9249335316+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN29077.101014531384unknown [Zea mays]
DDBJBAF24208.204844232467Os08g0525800 [Oryza sativa Japonica Group]
GenBankEAZ07710.104844332468hypothetical protein OsI_29967 [Oryza sativa Indica Group]
RefSeqNP_001062294.103544218467Os08g0525800 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002444717.1064531484hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0493361312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B0493361306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0493361306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghr_A0493361306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1aq0_B0493361306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
Transmembrane Domains
StartEnd
1335
Signal Peptide
Cleavage Site
34
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE181046257262480
DR8074512462114510
EE1582982721173490
EC9045942781173540
EX3405362971414320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)