Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00045738m |
Family | GT1 |
Protein Properties | Length: 162 Molecular Weight: 16993.4 Isoelectric Point: 9.3488 |
Chromosome | Chromosome/Scaffold: 0133425 Start: 547 End: 1435 |
Description | UDP-glycosyltransferase 73B4 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 8 | 128 | 1.3e-31 |
RGLLVRGWAPQAVILSHATVGGFVTHCGWNSTLEAITAGLPVVTWPHFTDQFLNEKMAVEVLGIGVSVGVKEPLAFQAANKEILVGRDVVEKAVRDIMGA GEEADGRRQRARELAAKARAA |
Full Sequence |
---|
Protein Sequence Length: 162 Download |
MEARVAGRGL LVRGWAPQAV ILSHATVGGF VTHCGWNSTL EAITAGLPVV TWPHFTDQFL 60 NEKMAVEVLG IGVSVGVKEP LAFQAANKEI LVGRDVVEKA VRDIMGAGEE ADGRRQRARE 120 LAAKARAAVQ EGGSSHANLL DLVKRFQKQG AAAPSDKSSA A* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
PLN00164 | PLN00164 | 2.0e-28 | 4 | 143 | 143 | + glucosyltransferase; Provisional |
PLN02863 | PLN02863 | 9.0e-29 | 2 | 75 | 74 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein |
PLN02448 | PLN02448 | 9.0e-30 | 7 | 144 | 139 | + UDP-glycosyltransferase family protein |
PLN03007 | PLN03007 | 1.0e-42 | 2 | 146 | 145 | + UDP-glucosyltransferase family protein |
PLN02534 | PLN02534 | 7.0e-47 | 2 | 149 | 150 | + UDP-glycosyltransferase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACN27741.1 | 0 | 1 | 147 | 348 | 494 | unknown [Zea mays] |
DDBJ | BAD24993.1 | 0 | 1 | 159 | 342 | 497 | putative flavonoid glucosyl-transferase [Oryza sativa Japonica Group] |
GenBank | EAZ22171.1 | 0 | 1 | 159 | 328 | 483 | hypothetical protein OsJ_05834 [Oryza sativa Japonica Group] |
RefSeq | XP_002438036.1 | 0 | 1 | 147 | 356 | 504 | hypothetical protein SORBIDRAFT_10g007060 [Sorghum bicolor] |
RefSeq | XP_002438093.1 | 0 | 1 | 160 | 352 | 513 | hypothetical protein SORBIDRAFT_10g007920 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2pq6_A | 4e-24 | 4 | 144 | 350 | 475 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vg8_A | 4e-22 | 4 | 135 | 335 | 456 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vch_A | 4e-22 | 4 | 135 | 335 | 456 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vce_A | 4e-22 | 4 | 135 | 335 | 456 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2acw_B | 5e-21 | 4 | 135 | 329 | 450 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
cytokinins-O-glucoside biosynthesis | RXN-4723 | EC-2.4.1.203 | trans-zeatin O-β-D-glucosyltransferase |
cytokinins-O-glucoside biosynthesis | RXN-4726 | EC-2.4.1 | UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase |
cytokinins-O-glucoside biosynthesis | RXN-4735 | EC-2.4.1.215 | cis-zeatin O-β-D-glucosyltransferase |
cytokinins-O-glucoside biosynthesis | RXN-4737 | EC-2.4.1 | dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FE658393 | 150 | 1 | 150 | 0 |
FE658392 | 150 | 1 | 150 | 0 |
FL855339 | 141 | 10 | 150 | 0 |
FL730638 | 148 | 1 | 148 | 0 |
FL808731 | 148 | 1 | 148 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|