CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00047509m
FamilyGT65
Protein PropertiesLength: 512 Molecular Weight: 57890.6 Isoelectric Point: 8.3144
ChromosomeChromosome/Scaffold: 015911 Start: 952 End: 3682
DescriptionO-fucosyltransferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT651474560
  GLNNQKIAFARACLTARFLNRSLLMPSLSASLFYKEVDLLQPIDFDKVFDFSKFNARCHGFVRLARYSEVLNRSEPLKLQKGSGRRWTVERDLDQLQQFI
  GGKADDSEVIEIVGKHPFLWPDHWPVKDYAKIFDCLVLVPEIETEVVKVISKIREAGQRARHEAGVSHSKQRRDGSTNLPIPYVAVHMRIEKDWMIHCKK
  WEQRSKSHEICSSKEEIIHKVSQITDLRRPVVVYLAVADSLLEDDSITSGWRVGMVAYEKKKLGVTDIYDRQPYLIKSAIDFEVCSRADVFVGNSFSTFS
  ILVVLSRTER
Full Sequence
Protein Sequence     Length: 512     Download
SGASSASRWS HTPPLPSGAG RARRGEERLP PPGRRCDGRG VLLFLLAEPP CGSIRADSYC    60
CCFSMLRVAL EHAQGLKWVL DPWGIFSNFY FPCLLIVIVL IVLRAILSPF LAINSSEKEE    120
FFESTVPDLF PGIRRDKFVE VPQIIWGLNN QKIAFARACL TARFLNRSLL MPSLSASLFY    180
KEVDLLQPID FDKVFDFSKF NARCHGFVRL ARYSEVLNRS EPLKLQKGSG RRWTVERDLD    240
QLQQFIGGKA DDSEVIEIVG KHPFLWPDHW PVKDYAKIFD CLVLVPEIET EVVKVISKIR    300
EAGQRARHEA GVSHSKQRRD GSTNLPIPYV AVHMRIEKDW MIHCKKWEQR SKSHEICSSK    360
EEIIHKVSQI TDLRRPVVVY LAVADSLLED DSITSGWRVG MVAYEKKKLG VTDIYDRQPY    420
LIKSAIDFEV CSRADVFVGN SFSTFSILVV LSRTERLYNL GKASSCGENI GLSSYAYNVM    480
GDDGGPQRWM TDMSDTNLQR LSYGTNNVSC H* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11302O-FucT-16.0e-5324453153+
cd11299O-FucT_plant4.0e-9147462346+
cd11296O-FucT_like6.0e-23297456164+
pfam10250O-FucT2.0e-31147454342+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN28408.1011451145442unknown [Zea mays]
EMBLCAH40837.1011451145441protein-O-fucosyltransferase 1 [Oryza sativa]
EMBLCAH40838.1011451145441protein-O-fucosyltransferase 1 [Saccharum officinarum]
RefSeqNP_001147772.1011451145442protein-O-fucosyltransferase 1 [Zea mays]
RefSeqXP_002451612.1011451145442hypothetical protein SORBIDRAFT_04g004590 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.003322453206344A Chain A, Crystal Structure Of The C-Terminal Domain (Residues 83-215) Of Pf1911 Hydrogenase From Pyrococcus Furiosus, Northeast Structural Genomics Consortium Target Pfr246a
PDB3zy5_A0.003322453206344A Chain A, Crystal Structure Of The C-Terminal Domain (Residues 83-215) Of Pf1911 Hydrogenase From Pyrococcus Furiosus, Northeast Structural Genomics Consortium Target Pfr246a
PDB3zy4_A0.003322453206344A Chain A, Crystal Structure Of The C-Terminal Domain (Residues 83-215) Of Pf1911 Hydrogenase From Pyrococcus Furiosus, Northeast Structural Genomics Consortium Target Pfr246a
PDB3zy3_B0.003322453206344A Chain A, Crystal Structure Of The C-Terminal Domain (Residues 83-215) Of Pf1911 Hydrogenase From Pyrococcus Furiosus, Northeast Structural Genomics Consortium Target Pfr246a
PDB3zy3_A0.003322453206344A Chain A, Crystal Structure Of The C-Terminal Domain (Residues 83-215) Of Pf1911 Hydrogenase From Pyrococcus Furiosus, Northeast Structural Genomics Consortium Target Pfr246a
Transmembrane Domains
StartEnd
85107
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8579223062075120
GO8602822782355120
GO8573533072075120
FE6520992371133490
FL9686362362214560
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma20g02800.3Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378
Glyma07g34965.3.189.378Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189
Glyma07g34965.3.70.189Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny