CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00047727m
FamilyCE10
Protein PropertiesLength: 319 Molecular Weight: 33985.1 Isoelectric Point: 5.0538
ChromosomeChromosome/Scaffold: 0162089 Start: 357 End: 1734
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE10323160
  TTPAGFDAATGVDSKDVVIDAATGATARLYLPPPLEGGATTTKLPVLVFFHGGYFIVGSAAEPMYHRYVNSLVARARVVAVSVEYRLAPEHPLPAAYDDS
  WAALGWAVSRADPWLSDHGDLGRVFLVGVSAGGNIVHNMALAVGASGLPAAEPARVEGVIELHPSFSGEQKTEVEDEVFFQANNNRWKVIFPGATGGADD
  PRINPTADGAPSLTKLAGQRLLVCTASEDPRAPRARDYCDAVRASGWRGEAEWFESEGEGHGFFVLNPRTSTAAALMDRVVGFLA
Full Sequence
Protein Sequence     Length: 319     Download
MDSGSREVAF DCSSFRLYMD GRVDRVPHRM ETTPAGFDAA TGVDSKDVVI DAATGATARL    60
YLPPPLEGGA TTTKLPVLVF FHGGYFIVGS AAEPMYHRYV NSLVARARVV AVSVEYRLAP    120
EHPLPAAYDD SWAALGWAVS RADPWLSDHG DLGRVFLVGV SAGGNIVHNM ALAVGASGLP    180
AAEPARVEGV IELHPSFSGE QKTEVEDEVF FQANNNRWKV IFPGATGGAD DPRINPTADG    240
APSLTKLAGQ RLLVCTASED PRAPRARDYC DAVRASGWRG EAEWFESEGE GHGFFVLNPR    300
TSTAAALMDR VVGFLAGH* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG2272PnbA3.0e-573179123+
cd00312Esterase_lipase2.0e-660179138+
pfam00135COesterase2.0e-774179120+
COG0657Aes3.0e-2435318287+
pfam07859Abhydrolase_33.0e-4178295224+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN28069.1013161313unknown [Zea mays]
GenBankEAZ09365.1013181319hypothetical protein OsI_31638 [Oryza sativa Indica Group]
RefSeqNP_001146161.1013151327hypothetical protein LOC100279730 [Zea mays]
RefSeqXP_002462487.1013181327hypothetical protein SORBIDRAFT_02g026550 [Sorghum bicolor]
RefSeqXP_002462487.1014315328631hypothetical protein SORBIDRAFT_02g026550 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2zsi_A3e-353531562348A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant
PDB2zsh_A3e-353531562348B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_F6e-341831547347B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_E6e-341831547347B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_D6e-341831547347B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Metabolic Pathways
Pathway NameReactionECProtein Name
formononetin biosynthesisRXN-3284EC-4.2.1.1052-hydroxyisoflavanone dehydratase
formononetin biosynthesisRXN-3625-2,7-dihydroxy-4'-methoxyisoflavanone dehydratase
isoflavonoid biosynthesis IRXN-3284EC-4.2.1.1052-hydroxyisoflavanone dehydratase
isoflavonoid biosynthesis IIRXN-3303EC-4.2.1.1052-hydroxyisoflavanone dehydratase
isoflavonoid biosynthesis IIRXN-5502-2,7,5-trihydroxy-4'-methoxyisoflavanone dehydratase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL780299246432880
FL79982822312230
FL92133021052120
FL8046441821383190
FL799828162172326.4
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00606.1.321.596Aquca_007_00606.1.321.596Aquca_015_00171.1Aquca_017_00080.1Aquca_015_00108.1
Aquca_015_00117.1Aquca_007_00602.1Aquca_028_00109.1Aquca_015_00115.1Aquca_054_00096.1
Aquca_007_00606.1.32.283Aquca_007_00606.1.32.283Aquca_007_00599.1Aquca_007_00607.1Aquca_007_00605.1
Aquca_007_00608.1
Arabidopsis lyrata485224484264473890891873891872
474099889348
Arabidopsis thalianaAT1G19190.1AT3G48700.1AT2G03550.1AT3G48690.1AT1G47480.1
AT1G49650.1AT1G49640.1AT1G49660.1
Brachypodium distachyonBradi4g32320.1Bradi4g32350.1Bradi3g38040.1Bradi4g32360.1Bradi1g45960.1
Bradi3g38045.1Bradi4g32080.1Bradi3g38080.1Bradi4g32310.1Bradi1g45930.1
Bradi4g32340.1Bradi1g45945.1Bradi3g38090.1Bradi1g45925.1Bradi4g32300.1
Bradi3g46460.1Bradi3g46450.1Bradi3g38060.1Bradi5g11800.1Bradi3g38050.1
Bradi4g32330.1Bradi1g74240.1Bradi3g38070.1
Brassica rapaBra019558Bra029912Bra029913Bra040667Bra014080
Bra016519Bra014213Bra018807Bra018808Bra018809
Bra025117Bra031068Bra025714
Carica papayaevm.model.supercontig_3272.2evm.model.supercontig_62.30evm.model.supercontig_62.31evm.TU.contig_24415.5evm.TU.contig_32334.1
evm.model.supercontig_2506.2evm.model.supercontig_2506.1evm.model.supercontig_1161.1evm.model.supercontig_62.32
Capsella rubellaCarubv10019264mCarubv10017570mCarubv10011237mCarubv10018816mCarubv10011932m
Carubv10009807mCarubv10011215m
Citrus sinensisorange1.1g021920morange1.1g039671morange1.1g021927morange1.1g043287morange1.1g042745m
orange1.1g022120morange1.1g020576morange1.1g043192morange1.1g019090morange1.1g046334m
orange1.1g018914morange1.1g042897morange1.1g047391morange1.1g046886morange1.1g045768m
orange1.1g036491morange1.1g036685morange1.1g036128morange1.1g042415m
Cucumis sativusCucsa.085230.1Cucsa.085220.1Cucsa.232690.1Cucsa.123550.1Cucsa.085210.1
Eucalyptus grandisEucgr.I01163.1Eucgr.L02920.1Eucgr.I01162.1Eucgr.G01495.1Eucgr.G01468.1
Eucgr.I01161.1Eucgr.G01469.1Eucgr.G01488.1Eucgr.G01474.1Eucgr.J02632.1
Eucgr.G01482.1Eucgr.G01481.1Eucgr.H03554.1Eucgr.J02629.1Eucgr.G01478.1
Eucgr.G01491.1Eucgr.H03555.1Eucgr.G01473.1Eucgr.F00244.1Eucgr.F00249.1
Eucgr.F00245.1Eucgr.F00251.1Eucgr.I01166.1Eucgr.F00250.1Eucgr.G01472.1
Eucgr.J02635.1Eucgr.F00248.1
Fragaria vescamrna28524.1-v1.0-hybrid.43.286mrna28524.1-v1.0-hybrid.43.286mrna28524.1-v1.0-hybrid.43.286mrna28526.1-v1.0-hybridmrna28525.1-v1.0-hybrid
mrna28521.1-v1.0-hybridmrna28508.1-v1.0-hybridmrna28530.1-v1.0-hybridmrna28520.1-v1.0-hybridmrna28611.1-v1.0-hybrid
mrna05895.1-v1.0-hybridmrna05894.1-v1.0-hybrid.369.649mrna05894.1-v1.0-hybrid.369.649mrna28615.1-v1.0-hybridmrna05894.1-v1.0-hybrid.44.323
mrna05894.1-v1.0-hybrid.44.323mrna28538.1-v1.0-hybridmrna05898.1-v1.0-hybrid.12.296mrna05898.1-v1.0-hybrid.12.296mrna17534.1-v1.0-hybrid
mrna05898.1-v1.0-hybrid.317.605mrna05898.1-v1.0-hybrid.317.605mrna09075.1-v1.0-hybridmrna28524.1-v1.0-hybrid.366.514mrna28524.1-v1.0-hybrid.366.514
mrna28524.1-v1.0-hybrid.366.514mrna09070.1-v1.0-hybridmrna28524.1-v1.0-hybrid.590.683mrna28524.1-v1.0-hybrid.590.683mrna28524.1-v1.0-hybrid.590.683
Glycine maxGlyma17g36220.1Glyma02g15160.1Glyma02g15150.1Glyma02g15120.1Glyma07g33330.1
Glyma10g39610.1Glyma01g45000.1Glyma01g44980.1Glyma20g28150.1Glyma01g45020.1
Glyma11g00650.1Glyma02g15170.1Glyma07g33320.1Glyma10g39600.1Glyma06g04140.1
Glyma04g03980.1Glyma02g15130.1Glyma07g33340.2
Gossypium raimondiiGorai.006G237000.1Gorai.009G210800.1Gorai.005G239400.1Gorai.005G103700.1Gorai.008G025200.1
Gorai.009G210700.1Gorai.005G239000.1Gorai.005G239200.1Gorai.005G239100.1Gorai.013G042500.1
Gorai.005G103600.1
Linum usitatissimumLus10027909Lus10012073Lus10019882Lus10014036Lus10021743
Lus10014033.130.379Lus10014033.130.379Lus10042662Lus10021745Lus10034068
Lus10019884Lus10014035Lus10019885Lus10014033.36.130Lus10014033.36.130
Malus domesticaMDP0000227827MDP0000554950MDP0000204521MDP0000167495MDP0000199442
MDP0000375330MDP0000939384MDP0000818542MDP0000569026MDP0000847523
MDP0000204319MDP0000164293MDP0000281635MDP0000143216MDP0000849027
MDP0000594621MDP0000431260MDP0000864575MDP0000173546MDP0000180763
MDP0000849585MDP0000794484MDP0000857937MDP0000269558MDP0000617328
MDP0000256478MDP0000198493MDP0000816142MDP0000413509
Manihot esculentacassava4.1_013627mcassava4.1_030588mcassava4.1_026915mcassava4.1_032921mcassava4.1_034056m
cassava4.1_013203mcassava4.1_011889mcassava4.1_011928mcassava4.1_029685mcassava4.1_025530m
cassava4.1_032193mcassava4.1_027531m
Medicago truncatulaMedtr4g086510.1Medtr4g086480.1Medtr4g086470.1Medtr5g005920.1Medtr4g086540.1
Medtr5g005850.1Medtr8g040860.1Medtr3g101420.1Medtr1g105020.1Medtr1g104930.1.37.322
Medtr1g104930.1.37.322Medtr7g051020.1Medtr5g005900.1Medtr1g104930.1.359.644Medtr1g104930.1.359.644
Mimulus guttatusmgv1a010621mmgv1a024424mmgv1a026137mmgv1a026120mmgv1a025384m
mgv1a027087mmgv1a018666mmgv1a027056mmgv1a009954m
Oryza sativaLOC_Os07g34280.1LOC_Os07g34240.1LOC_Os07g34170.1LOC_Os07g34370.1LOC_Os09g28620.1
LOC_Os06g11135.1LOC_Os08g37060.1LOC_Os09g28750.1LOC_Os06g11130.1LOC_Os09g28650.1
LOC_Os09g28720.1LOC_Os09g28690.1LOC_Os09g28630.1LOC_Os09g28640.1LOC_Os06g11090.1
LOC_Os09g28740.1LOC_Os08g37050.1LOC_Os09g28280.1LOC_Os08g37010.1LOC_Os09g28660.1
LOC_Os04g37680.1LOC_Os08g37040.1LOC_Os07g31790.1LOC_Os08g37030.1LOC_Os09g26500.1
LOC_Os02g53960.1LOC_Os02g35940.1LOC_Os09g28230.1LOC_Os09g26490.1LOC_Os09g28730.1
Panicum virgatumPavirv00010950mPavirv00059932mPavirv00059669mPavirv00048957mPavirv00036486m
Pavirv00041653mPavirv00066993mPavirv00022926mPavirv00031619mPavirv00001305m
Pavirv00008370mPavirv00034008mPavirv00015345mPavirv00043956mPavirv00021034m
Pavirv00016224mPavirv00011282mPavirv00018935mPavirv00057305mPavirv00028685m
Pavirv00051325mPavirv00025716mPavirv00004795mPavirv00063650mPavirv00013381m
Pavirv00042358mPavirv00005219mPavirv00021754mPavirv00044490mPavirv00028359m
Pavirv00001805mPavirv00053058mPavirv00017045mPavirv00060730mPavirv00015344m
Pavirv00035674mPavirv00070588mPavirv00011281mPavirv00060290mPavirv00010525m
Pavirv00039903mPavirv00036503mPavirv00017037mPavirv00064437mPavirv00033220m
Pavirv00057127mPavirv00011407mPavirv00044972mPavirv00014292mPavirv00028361m
Pavirv00041308mPavirv00003420mPavirv00039358mPavirv00066709mPavirv00041518m
Pavirv00020850mPavirv00055834mPavirv00003513mPavirv00064414mPavirv00048233m
Pavirv00066949mPavirv00067390mPavirv00028157mPavirv00054492mPavirv00002162m
Pavirv00041087mPavirv00048523mPavirv00051389mPavirv00048779m
Phaseolus vulgarisPhvul.003G295300.1Phvul.003G295200.1Phvul.003G295100.1Phvul.003G295000.1Phvul.007G054300.1
Phvul.002G047500.1Phvul.009G063600.1Phvul.007G054200.1Phvul.007G054400.1Phvul.001G020500.1
Picea abiesMA_384628g0010MA_10429351g0010MA_10374213g0010MA_10435734g0010MA_81147g0010
MA_893141g0010MA_7763304g0010MA_104449g0020MA_872227g0010MA_2054728g0010
MA_10189777g0010
Populus trichocarpaPotri.004G142800.1Potri.009G104600.1Potri.004G142900.1Potri.009G105100.1Potri.004G142400.1
Potri.009G104100.1Potri.009G104000.1Potri.009G104900.1Potri.009G104300.1Potri.009G103800.1
Potri.009G104400.1Potri.009G105000.1Potri.014G032700.1Potri.004G143200.1Potri.014G032800.1
Potri.014G032600.1Potri.009G104700.1Potri.004G143100.1Potri.004G143200.2Potri.009G104200.1
Potri.014G032500.1
Prunus persicappa009174mppa026088mppa021861mppa008902mppa021907m
ppb022581mppa009160mppa007279mppa027099mppa007658m
ppa008575mppa008552mppa008795mppa021622mppa020422m
ppa009150mppa022718mppa021391m
Ricinus communis29801.m00320929168.m00036829168.m00036929801.m00321029801.m003171
29206.m00014529801.m00320829801.m00321130005.m00125429844.m003358
30170.m01390729801.m00321230170.m01390830179.m000575
Setaria italicaSi006900mSi008230mSi013972mSi014057mSi030499m
Si010584mSi032884mSi030180mSi030599mSi006704m
Si030193mSi006872mSi030583mSi030333mSi008594m
Si030549mSi013922mSi008542mSi032135mSi036667m
Si026497mSi013984mSi030607mSi033100mSi015649m
Si015677mSi032992mSi015570mSi031952mSi006888m
Si030298mSi031940mSi014909mSi010617mSi008447m
Si025325m
Sorghum bicolorSb02g026800.1Sb02g001850.1Sb10g007228.1Sb02g026816.1Sb02g026790.2
Sb02g026790.1Sb08g017820.1Sb10g007224.1Sb10g007226.1Sb02g026550.1.339.632
Sb02g026550.1.339.632Sb02g026550.1.33.325Sb02g026550.1.33.325Sb04g023520.1Sb10g008950.1
Sb07g023110.1Sb07g023140.1Sb09g014531.1Sb07g023070.1
Thellungiella halophilaThhalv10010541mThhalv10011580mThhalv10004622mThhalv10011663mThhalv10012216m
Thhalv10012081m
Vitis viniferaGSVIVT01031776001GSVIVT01009528001GSVIVT01031770001GSVIVT01031772001GSVIVT01031769001
GSVIVT01031773001.521.663GSVIVT01031773001.521.663GSVIVT01031773001.233.348GSVIVT01031773001.233.348GSVIVT01031775001
GSVIVT01035846001.57.161GSVIVT01035846001.57.161GSVIVT01035846001.57.161GSVIVT01035846001.57.161GSVIVT01017924001
Zea maysAC218900.3_FGT001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)