| Basic Information | |
|---|---|
| Species | Panicum virgatum |
| Cazyme ID | Pavirv00050690m |
| Family | GH1 |
| Protein Properties | Length: 157 Molecular Weight: 16697 Isoelectric Point: 10.2295 |
| Chromosome | Chromosome/Scaffold: 070800 Start: 778 End: 1609 |
| Description | beta glucosidase 31 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 68 | 154 | 5.59959e-42 |
| RHSFPKDFIFGTGSAAYQYEGAYKEGGKGLSIWDKFTHIPGKILNNDNGDVALDMYHRYKGDVQLLKDMNMDSFRFSIAWSRILPSE | |||
| Full Sequence |
|---|
| Protein Sequence Length: 157 Download |
| KGRGIAAGTE SAAANPGPGR GRGRSQPSVP ALALGMGART GMAAKRLLSS VLLVAALACD 60 GTHAKFSRHS FPKDFIFGTG SAAYQYEGAY KEGGKGLSIW DKFTHIPGKI LNNDNGDVAL 120 DMYHRYKGDV QLLKDMNMDS FRFSIAWSRI LPSEHP* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02849 | PLN02849 | 5.0e-27 | 66 | 152 | 87 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 3.0e-30 | 66 | 153 | 88 | + beta-glucosidase | ||
| COG2723 | BglB | 2.0e-37 | 71 | 154 | 86 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| TIGR03356 | BGL | 2.0e-41 | 72 | 153 | 82 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 3.0e-42 | 70 | 152 | 83 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAL14713.1 | 0 | 36 | 153 | 1 | 114 | beta-glucosidase isozyme 2 precursor [Oryza sativa Japonica Group] |
| GenBank | EAZ09573.1 | 0 | 36 | 153 | 1 | 114 | hypothetical protein OsI_31852 [Oryza sativa Indica Group] |
| GenBank | EAZ45194.1 | 0 | 36 | 153 | 1 | 114 | hypothetical protein OsJ_29837 [Oryza sativa Japonica Group] |
| RefSeq | NP_001063539.1 | 0 | 36 | 153 | 1 | 114 | Os09g0491100 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002462569.1 | 0 | 59 | 153 | 22 | 116 | hypothetical protein SORBIDRAFT_02g028400 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ahx_D | 3e-33 | 71 | 152 | 6 | 87 | A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans |
| PDB | 3ahx_C | 3e-33 | 71 | 152 | 6 | 87 | A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans |
| PDB | 3ahx_B | 3e-33 | 71 | 152 | 6 | 87 | A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans |
| PDB | 3ahx_A | 3e-33 | 71 | 152 | 6 | 87 | A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans |
| PDB | 3gnr_A | 2e-32 | 66 | 153 | 12 | 99 | A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FL852831 | 153 | 1 | 153 | 0 |
| FL690511 | 125 | 29 | 153 | 0 |
| FE649011 | 125 | 29 | 153 | 0 |
| FL697937 | 125 | 29 | 153 | 0 |
| FL712635 | 125 | 29 | 153 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |