Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00051192m |
Family | GT8 |
Protein Properties | Length: 201 Molecular Weight: 23444 Isoelectric Point: 6.5069 |
Chromosome | Chromosome/Scaffold: 0231647 Start: 286 End: 1318 |
Description | Nucleotide-diphospho-sugar transferases superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT8 | 5 | 157 | 3.6e-24 |
VKVVSVENLKNPYEKQENFNMRFKLTLNKLYAWSLVSYERVVMLDSDNIFLQNTDELFQCGRFCAVFINPCIFHTGLFVLKPSMDVFKNMLHELAVGREN PDGADQGFLASYFPDLLDQPMFHPPANGTKLEGTYRLPLGYQMDASYYYLKLR |
Full Sequence |
---|
Protein Sequence Length: 201 Download |
KDDGVKVVSV ENLKNPYEKQ ENFNMRFKLT LNKLYAWSLV SYERVVMLDS DNIFLQNTDE 60 LFQCGRFCAV FINPCIFHTG LFVLKPSMDV FKNMLHELAV GRENPDGADQ GFLASYFPDL 120 LDQPMFHPPA NGTKLEGTYR LPLGYQMDAS YYYLKLRWSI PCGPNSVITF PSAPLFKPWY 180 WWSWPVLPLG LSWHEQRREN L |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd06914 | GT8_GNT1 | 1.0e-5 | 3 | 179 | 198 | + GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases. | ||
COG5597 | COG5597 | 1.0e-5 | 26 | 119 | 103 | + Alpha-N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] | ||
PLN00176 | PLN00176 | 2.0e-6 | 16 | 119 | 141 | + galactinol synthase | ||
pfam01501 | Glyco_transf_8 | 2.0e-7 | 28 | 183 | 184 | + Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase. | ||
cd02537 | GT8_Glycogenin | 4.0e-53 | 1 | 199 | 209 | + Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0006486 | protein glycosylation |
GO:0016757 | transferase activity, transferring glycosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAG90419.1 | 0 | 25 | 201 | 1 | 177 | unnamed protein product [Oryza sativa Japonica Group] |
EMBL | CAH67416.1 | 0 | 1 | 201 | 95 | 295 | OSIGBa0143N19.10 [Oryza sativa (indica cultivar-group)] |
GenBank | EEC77769.1 | 0 | 1 | 201 | 95 | 295 | hypothetical protein OsI_16920 [Oryza sativa Indica Group] |
RefSeq | NP_001053509.1 | 0 | 1 | 201 | 49 | 249 | Os04g0553800 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002448294.1 | 0 | 1 | 201 | 96 | 296 | hypothetical protein SORBIDRAFT_06g024740 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3u2x_B | 0.000000000002 | 29 | 117 | 83 | 172 | A Chain A, Structure Of The Chitinase From Jack Bean |
PDB | 3u2x_A | 0.000000000002 | 29 | 117 | 83 | 172 | A Chain A, Structure Of The Chitinase From Jack Bean |
PDB | 3u2v_B | 0.000000000002 | 29 | 117 | 83 | 172 | A Chain A, Structure Of The Chitinase From Jack Bean |
PDB | 3u2v_A | 0.000000000002 | 29 | 117 | 83 | 172 | A Chain A, Structure Of The Chitinase From Jack Bean |
PDB | 3u2u_B | 0.000000000002 | 29 | 117 | 83 | 172 | A Chain A, Structure Of The Chitinase From Jack Bean |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FG960847 | 199 | 3 | 201 | 0 |
HS381905 | 201 | 1 | 201 | 0 |
DV521507 | 196 | 1 | 196 | 0 |
HO810590 | 201 | 1 | 201 | 0 |
CA007817 | 184 | 17 | 200 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|