y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00052192m
FamilyGT41
Protein PropertiesLength: 912 Molecular Weight: 101102 Isoelectric Point: 5.8413
ChromosomeChromosome/Scaffold: 011550 Start: 4804 End: 11407
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT413498570
  IKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGSITLAIQAYERCLQIDPDSRNACQNRLLAMNYIDEGSDDKLYEAHR
  EWGKRFMKLYPQHTSWDNSKIADRPLIIGYVSPDYFTHSVSYFIEAPLTHHDYTNCKVVVYSGVVKADAKTLRFKDKVLKKGGLWRDIYGIDEKKVASLV
  REDKVDILVELTGHTANNKLGTLACRPAPIQVTWIGYPNTTGLPTIDYRITDSLADPPSTKQKHVEELVRLPESFLCYTPSPEAGPVCPTPAISNGFITF
  GSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSIRQKFLSTLEELGLESLRVDLLPLIHLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMG
  VPCVTMAGAVHAHNVGVSLLSKVGLGRLVAKTEDEYVSLALDLASDVNALQELRMSLRELMMKSPFCDGERFTRSLEAAYRNMWHRYCDGDVPSLRRLEL
  LQEHPIVNK
Full Sequence
Protein Sequence     Length: 912     Download
MGQPGMDSVQ GKESNGVAPD RNGGASPAKQ QLEGKEALRY ANILRSRNKF ADAIQLYNTV    60
LEKEGANVEA LIGKGICLQA QSLPRQAIEC FTEAVKIEPQ NACALTHCGM IYKDEGHLVE    120
AAEAYQKART ADPSYKPASE FLAIVLTDLG TSLKLAGNTE EGIQKYCEAL EVDNHYAPAY    180
YNLGVVYSEM MQFDTALTCY EKAALERPLY AEAYCNMGVI YKNRGELEAA IACYERCLTI    240
SPNFEIAKNN MAIALTDLGT KVKIEGDIIQ GVTYYKKALF YNWHYADAMY NLGVAYGEML    300
NFEMAIVFYE LALHFNPRCA EACNNLGVIY KDRDNLDKAV ECYQMALSIK PNFSQSLNNL    360
GVVYTVQGKM DAAASMIEKA IIANPTYAEA YNNLGVLYRD AGSITLAIQA YERCLQIDPD    420
SRNACQNRLL AMNYIDEGSD DKLYEAHREW GKRFMKLYPQ HTSWDNSKIA DRPLIIGYVS    480
PDYFTHSVSY FIEAPLTHHD YTNCKVVVYS GVVKADAKTL RFKDKVLKKG GLWRDIYGID    540
EKKVASLVRE DKVDILVELT GHTANNKLGT LACRPAPIQV TWIGYPNTTG LPTIDYRITD    600
SLADPPSTKQ KHVEELVRLP ESFLCYTPSP EAGPVCPTPA ISNGFITFGS FNNLAKITPK    660
VLQVWARILC AVPNSRLVVK CKPFCCDSIR QKFLSTLEEL GLESLRVDLL PLIHLNHDHM    720
QAYSLMDISL DTFPYAGTTT TCESLYMGVP CVTMAGAVHA HNVGVSLLSK VGLGRLVAKT    780
EDEYVSLALD LASDVNALQE LRMSLRELMM KSPFCDGERF TRSLEAAYRN MWHRYCDGDV    840
PSLRRLELLQ EHPIVNKQDS DKTAEKLADL KAQKENAAVE EDKQPPIMAN GASSPGSPAS    900
AKCEANGHCS Q*                                                        960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00189TPR2.0e-1814524399+
cd00189TPR3.0e-21321420100+
COG3914Spy3.0e-91305835552+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC84033.1069111947hypothetical protein OsI_30264 [Oryza sativa Indica Group]
GenBankEEE69149.1069111947hypothetical protein OsJ_28275 [Oryza sativa Japonica Group]
RefSeqNP_001062501.1019111927Os08g0559300 [Oryza sativa (japonica cultivar-group)]
Swiss-ProtO82422069111944SPY_HORVU RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY; AltName: Full=HvSPY
RefSeqXP_002445679.1019081908hypothetical protein SORBIDRAFT_07g024110 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D1e-362086246386A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB4gz6_D3e-23646841524715A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB4gz6_D3e-16992556155A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB4gz6_D0.0000000000000514629312152A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB4gz6_D0.0000000021763278152A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8676003273076330
GT0417893373316670
GO8676001191482640.0000000000005
GO8676001472003440.000000000001
GO867600126431660.32
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)