Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00056277m |
Family | GT1 |
Protein Properties | Length: 137 Molecular Weight: 14676 Isoelectric Point: 8.0953 |
Chromosome | Chromosome/Scaffold: 079621 Start: 1389 End: 3133 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 9 | 99 | 7.8e-26 |
VHHGGAGTTAAGLKAACPTTIIPFFGDQFFWGSMVHARGLGAPPVPVEQLQLNSLVDAIKFMIDPKVKERAVELAKAIESEDGVDGAVRSF |
Full Sequence |
---|
Protein Sequence Length: 137 Download |
MQSSCPFQVH HGGAGTTAAG LKAACPTTII PFFGDQFFWG SMVHARGLGA PPVPVEQLQL 60 NSLVDAIKFM IDPKVKERAV ELAKAIESED GVDGAVRSFL KHLPQQRDSE TMPTAQPSTF 120 MRPLLLPVKR CFGIAS* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG1819 | COG1819 | 9.0e-7 | 9 | 111 | 104 | + Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] | ||
cd03784 | GT1_Gtf_like | 3.0e-19 | 9 | 102 | 94 | + This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACD03256.1 | 0 | 5 | 135 | 36 | 165 | UDP-glycosyltransferase [Avena strigosa] |
DDBJ | BAC15827.1 | 0 | 5 | 136 | 485 | 617 | putative UDP-glucose:sterol glucosyltransferase [Oryza sativa Japonica Group] |
DDBJ | BAH01184.1 | 0 | 5 | 136 | 448 | 580 | unnamed protein product [Oryza sativa Japonica Group] |
RefSeq | NP_001059477.1 | 0 | 5 | 127 | 462 | 585 | Os07g0419500 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002461897.1 | 0 | 5 | 136 | 426 | 557 | hypothetical protein SORBIDRAFT_02g010030 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3h4t_A | 0.00000001 | 9 | 109 | 289 | 387 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
PDB | 3h4i_A | 0.00000001 | 9 | 109 | 289 | 387 | A Chain A, Chimeric Glycosyltransferase For The Generation Of Novel Natural Products |
PDB | 1iir_A | 0.000001 | 9 | 107 | 306 | 402 | A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb |
PDB | 4g2t_A | 0.0007 | 4 | 72 | 299 | 366 | A Chain A, Crystal Structure Of Streptomyces Sp. Sf2575 Glycosyltransferase Ssfs6, Complexed With Thymidine Diphosphate |
PDB | 4fzr_A | 0.0007 | 4 | 72 | 300 | 367 | A Chain A, Crystal Structure Of Ssfs6, Streptomyces Sp. Sf2575 Glycosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FL785639 | 133 | 5 | 137 | 0 |
FL803130 | 113 | 25 | 137 | 0 |
JG787705 | 133 | 5 | 137 | 0 |
FL915782 | 119 | 5 | 123 | 0 |
CO445747 | 129 | 9 | 137 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|