| Basic Information | |
|---|---|
| Species | Panicum virgatum |
| Cazyme ID | Pavirv00056446m |
| Family | GH1 |
| Protein Properties | Length: 161 Molecular Weight: 17800.2 Isoelectric Point: 6.9557 |
| Chromosome | Chromosome/Scaffold: 075615 Start: 468 End: 3406 |
| Description | beta glucosidase 31 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH1 | 25 | 160 | 0 |
| RNSFHEDFIFGTGSAAYQYEGAYKEGGKGLSVWDIFSHIPGKIKNNDTGDVADDFYHRYKEDVKLLKDMNLDAFRFSIAWTRILPTGSLSGGINKEGVAF YNNLINEVIANGLKPFVTIFHWDTPLALESKYGGFL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 161 Download |
| MARRALSALL LTALACDVAY AKFGRNSFHE DFIFGTGSAA YQYEGAYKEG GKGLSVWDIF 60 SHIPGKIKNN DTGDVADDFY HRYKEDVKLL KDMNLDAFRF SIAWTRILPT GSLSGGINKE 120 GVAFYNNLIN EVIANGLKPF VTIFHWDTPL ALESKYGGFL * |
| Functional Domains Download unfiltered results here | ||||||
|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
| PLN02998 | PLN02998 | 5.0e-45 | 18 | 160 | 143 | + beta-glucosidase |
| PLN02814 | PLN02814 | 1.0e-47 | 23 | 160 | 138 | + beta-glucosidase |
| COG2723 | BglB | 4.0e-59 | 25 | 160 | 138 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] |
| TIGR03356 | BGL | 2.0e-63 | 30 | 160 | 131 | + beta-galactosidase. |
| pfam00232 | Glyco_hydro_1 | 2.0e-65 | 24 | 160 | 137 | + Glycosyl hydrolase family 1. |
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAL14713.1 | 0 | 1 | 160 | 5 | 164 | beta-glucosidase isozyme 2 precursor [Oryza sativa Japonica Group] |
| GenBank | EAZ09573.1 | 0 | 1 | 160 | 5 | 164 | hypothetical protein OsI_31852 [Oryza sativa Indica Group] |
| GenBank | EAZ45194.1 | 0 | 1 | 160 | 5 | 164 | hypothetical protein OsJ_29837 [Oryza sativa Japonica Group] |
| RefSeq | NP_001063539.1 | 0 | 1 | 160 | 5 | 164 | Os09g0491100 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002462569.1 | 0 | 16 | 160 | 22 | 166 | hypothetical protein SORBIDRAFT_02g028400 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1cbg_A | 0 | 20 | 160 | 11 | 152 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 4a3y_B | 0 | 21 | 160 | 15 | 155 | A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway |
| PDB | 4a3y_A | 0 | 21 | 160 | 15 | 155 | A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway |
| PDB | 4ek7_B | 0 | 21 | 160 | 15 | 155 | A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway |
| PDB | 4ek7_A | 0 | 21 | 160 | 15 | 155 | A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
