| Basic Information | |
|---|---|
| Species | Panicum virgatum |
| Cazyme ID | Pavirv00056463m |
| Family | GH1 |
| Protein Properties | Length: 135 Molecular Weight: 15714.9 Isoelectric Point: 9.8632 |
| Chromosome | Chromosome/Scaffold: 079950 Start: 2833 End: 3586 |
| Description | beta-glucosidase 47 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 1 | 112 | 1.79366e-43 |
| MEQVVMYYKKRYKNTPTYITENGYAQASNSSMTAKDFTNDTQRIDYIHDYLTFLASAIRKGADVRGYFLWSLLDCFEWTSGYTLRLGLYHVDLKTLERTP KLSVEWFRNFLK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 135 Download |
| MEQVVMYYKK RYKNTPTYIT ENGYAQASNS SMTAKDFTND TQRIDYIHDY LTFLASAIRK 60 GADVRGYFLW SLLDCFEWTS GYTLRLGLYH VDLKTLERTP KLSVEWFRNF LKGSLVVGTR 120 PRKGHSQLKQ YTAQ* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02814 | PLN02814 | 9.0e-28 | 1 | 120 | 122 | + beta-glucosidase | ||
| COG2723 | BglB | 6.0e-28 | 4 | 109 | 108 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PLN02998 | PLN02998 | 3.0e-28 | 1 | 115 | 117 | + beta-glucosidase | ||
| pfam00232 | Glyco_hydro_1 | 2.0e-34 | 4 | 113 | 111 | + Glycosyl hydrolase family 1. | ||
| TIGR03356 | BGL | 1.0e-37 | 1 | 107 | 107 | + beta-galactosidase. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_001053302.1 | 0 | 1 | 133 | 385 | 515 | Os04g0513100 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002448169.1 | 0 | 1 | 113 | 381 | 493 | hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor] |
| RefSeq | XP_002448173.1 | 0 | 1 | 133 | 386 | 515 | hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor] |
| RefSeq | XP_002448174.1 | 0 | 1 | 127 | 388 | 513 | hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor] |
| RefSeq | XP_002448175.1 | 0 | 1 | 133 | 1 | 132 | hypothetical protein SORBIDRAFT_06g022470 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3gnr_A | 5e-31 | 1 | 112 | 374 | 487 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
| PDB | 3gnp_A | 5e-31 | 1 | 112 | 374 | 487 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
| PDB | 3gno_A | 5e-31 | 1 | 112 | 374 | 487 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 2rgm_B | 2e-27 | 1 | 112 | 371 | 480 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 2rgm_A | 2e-27 | 1 | 112 | 371 | 480 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| HO293838 | 135 | 1 | 135 | 0 |
| JG911579 | 135 | 1 | 135 | 0 |
| HO293837 | 130 | 1 | 130 | 0 |
| JG868275 | 127 | 9 | 135 | 0 |
| FL736170 | 114 | 22 | 135 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Fragaria vesca | mrna19576.1-v1.0-hybrid | ||||
| Panicum virgatum | Pavirv00028433m | Pavirv00028432m | |||
| Sorghum bicolor | Sb06g022470.1 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |