y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00056704m
FamilyGT47
Protein PropertiesLength: 437 Molecular Weight: 48784.2 Isoelectric Point: 9.8637
ChromosomeChromosome/Scaffold: 078828 Start: 624 End: 2687
DescriptionExostosin family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT471034230
  PVKIYMYDLPPKFTYGVVRSYTAARAPSGSADAAAVLPDEQLRYPGHQHLAEWWLFKDLLRRRPRDRPVARVDDPRDADLFYVPFFSSLSLVVNPIRPPA
  AANASGVAAAYSDEAMQDELLEWLERQPYWRRHWGRDHVFICQDPNALYRVIDWISNAILLVSDFGRLRTDQASLVKDVILPYSHRINSFKGDVGIDGRP
  SLLFFMGNRYRKEGGKVRDALFQILENEEDVTIKHGAQSRESRRAATRGMHSSKFCLHPAGDTPSACRLFDALVSLCVPVIVSDYIELPFEDVIDYSSIS
  IFVGTSKAVQPGYLTSMLRRV
Full Sequence
Protein Sequence     Length: 437     Download
MWERGRPPRK PRPSPIIVPP PPPSPPPRLN LLLPRSLLAL AARAMPSRRP SPVLLLLLAL    60
ALALLFLLLS PSSPSASRLS RSLASGYASA SSSPASPAAP PAPVKIYMYD LPPKFTYGVV    120
RSYTAARAPS GSADAAAVLP DEQLRYPGHQ HLAEWWLFKD LLRRRPRDRP VARVDDPRDA    180
DLFYVPFFSS LSLVVNPIRP PAAANASGVA AAYSDEAMQD ELLEWLERQP YWRRHWGRDH    240
VFICQDPNAL YRVIDWISNA ILLVSDFGRL RTDQASLVKD VILPYSHRIN SFKGDVGIDG    300
RPSLLFFMGN RYRKEGGKVR DALFQILENE EDVTIKHGAQ SRESRRAATR GMHSSKFCLH    360
PAGDTPSACR LFDALVSLCV PVIVSDYIEL PFEDVIDYSS ISIFVGTSKA VQPGYLTSML    420
RRVSSERILE YQREINK                                                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin1.0e-60104423331+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG27631.1010443760393exostosin-like [Zea mays]
GenBankACN31783.10104437104437unknown [Zea mays]
GenBankEEE67431.1014371439hypothetical protein OsJ_24780 [Oryza sativa Japonica Group]
RefSeqNP_001060019.1014371439Os07g0567000 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002460871.104343743437hypothetical protein SORBIDRAFT_02g036640 [Sorghum bicolor]
Transmembrane Domains
StartEnd
5375
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG8121502142244370
JG7789751912474370
ES8053302961444370
EX6744232481904370
DV7107632221834040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_040_00053.1Aquca_013_00618.5Aquca_030_00332.1Aquca_009_00090.1Aquca_042_00116.2
Aquca_042_00116.1Aquca_023_00060.1Aquca_002_00598.3Aquca_002_00598.2Aquca_002_00598.1
Aquca_013_00618.4Aquca_013_00618.3Aquca_013_00618.2Aquca_013_00618.1
Arabidopsis lyrata482474313939494490338977476604
477609484930909677
Arabidopsis thalianaAT2G35100.1AT5G44930.2AT5G44930.1AT1G67410.1AT3G03650.1
AT1G74680.1AT3G45400.1AT1G34270.1AT5G16890.1
Brachypodium distachyonBradi2g53000.1Bradi1g63740.1Bradi1g24360.1Bradi2g59047.1Bradi4g26150.1
Bradi3g37030.1Bradi5g25660.1
Brassica rapaBra005369Bra023001Bra034000Bra036746Bra004088
Bra031981Bra038288Bra003790Bra023587Bra006378
Bra028047Bra008584
Carica papayaevm.model.supercontig_30.157evm.model.supercontig_43.42evm.model.supercontig_73.11evm.model.supercontig_43.87evm.model.supercontig_111.8
evm.model.supercontig_66.112
Capsella rubellaCarubv10025262mCarubv10026328mCarubv10009012mCarubv10020184mCarubv10016173m
Carubv10017118mCarubv10020282mCarubv10002876mCarubv10015810m
Citrus clementinaCiclev10031603mCiclev10031600mCiclev10015089mCiclev10031340mCiclev10019794m
Ciclev10019803mCiclev10000997mCiclev10019875m
Citrus sinensisorange1.1g014095morange1.1g014048morange1.1g011685morange1.1g011195morange1.1g010594m
orange1.1g011757morange1.1g011167morange1.1g011152m
Cucumis sativusCucsa.056260.1Cucsa.236080.1Cucsa.332740.1Cucsa.090160.1Cucsa.112780.1
Eucalyptus grandisEucgr.B03487.1Eucgr.E04252.1Eucgr.A02153.1Eucgr.K00083.1Eucgr.F02636.1
Eucgr.B00504.1Eucgr.F01298.1
Fragaria vescamrna20016.1-v1.0-hybridmrna12575.1-v1.0-hybridmrna27505.1-v1.0-hybridmrna06060.1-v1.0-hybridmrna26011.1-v1.0-hybrid
Glycine maxGlyma19g29730.1Glyma07g34570.1Glyma20g02340.1Glyma03g00910.1Glyma01g07060.1
Glyma17g10840.1Glyma06g20840.2Glyma08g10920.1Glyma04g33600.2Glyma05g27950.1
Glyma11g11550.1Glyma12g02010.3Glyma12g02010.1Glyma20g31360.1Glyma02g12920.2
Glyma10g36230.1Glyma05g01051.1Glyma04g33600.1
Gossypium raimondiiGorai.003G052700.2Gorai.009G332700.2Gorai.009G332700.1Gorai.005G267400.2Gorai.005G267400.1
Gorai.002G184100.2Gorai.005G168600.1Gorai.002G184100.1Gorai.013G196700.1Gorai.004G257200.1
Gorai.007G252800.1Gorai.003G052700.1Gorai.004G113300.1Gorai.005G075900.2Gorai.005G075900.1
Gorai.011G272600.1Gorai.002G184100.3Gorai.002G184100.4
Linum usitatissimumLus10036219Lus10038355Lus10039145Lus10013787Lus10033734
Lus10003870Lus10037016Lus10015791Lus10020308Lus10005684
Lus10002060Lus10031610Lus10013627Lus10024214
Malus domesticaMDP0000223942MDP0000195867MDP0000199026MDP0000175549MDP0000558976
MDP0000482184MDP0000419029MDP0000282146MDP0000266169MDP0000245563
MDP0000693745MDP0000279572MDP0000162640MDP0000200985MDP0000241559
MDP0000206538
Manihot esculentacassava4.1_023143mcassava4.1_006493mcassava4.1_007991mcassava4.1_022793mcassava4.1_032917m
cassava4.1_005963mcassava4.1_006429mcassava4.1_006323mcassava4.1_006525m
Medicago truncatulaMedtr4g078020.1Medtr4g077920.1Medtr3g085480.1Medtr4g084200.1Medtr7g087100.1
Medtr7g087120.1
Mimulus guttatusmgv1a009897mmgv1a010020mmgv1a005660mmgv1a022533mmgv1a004804m
mgv1a005938mmgv1a020908mmgv1a005291mmgv1a019485mmgv1a005764m
Oryza sativaLOC_Os01g59630.1LOC_Os04g57510.1LOC_Os07g37960.1LOC_Os01g69220.1LOC_Os12g03100.1
LOC_Os11g03410.1LOC_Os08g34020.2LOC_Os08g34020.1LOC_Os03g20850.1LOC_Os04g57510.2
Panicum virgatumPavirv00014489mPavirv00064353mPavirv00049701mPavirv00020813mPavirv00002856m
Pavirv00019260mPavirv00022063mPavirv00039830mPavirv00041807mPavirv00048056m
Pavirv00007724mPavirv00054522m
Physcomitrella patensPp1s307_10V6.2Pp1s307_10V6.1Pp1s237_53V6.1Pp1s169_88V6.1Pp1s45_211V6.1
Pp1s39_178V6.1Pp1s15_277V6.1Pp1s48_110V6.1Pp1s326_70V6.1Pp1s30_180V6.1
Pp1s106_65V6.1Pp1s34_108V6.1Pp1s34_108V6.2
Phaseolus vulgarisPhvul.002G097200.1Phvul.001G107400.1Phvul.003G190200.1Phvul.004G074100.1Phvul.002G174100.1
Phvul.009G187300.1Phvul.011G019900.1Phvul.007G087100.1
Picea abiesMA_10428894g0010MA_10427831g0010MA_104022g0010MA_168957g0010MA_10429747g0010
MA_10429909g0020MA_362407g0010MA_7513659g0010
Populus trichocarpaPotri.019G049800.3Potri.015G124800.2Potri.015G124800.1Potri.008G034500.1Potri.013G116200.1
Potri.012G124600.1Potri.013G067400.2Potri.013G067400.1Potri.019G044600.2Potri.019G044600.1
Potri.002G210000.1Potri.019G049800.2Potri.019G049800.1Potri.T071700.3Potri.T071700.2
Potri.T071700.1Potri.019G086800.1Potri.005G055000.1Potri.012G135800.1
Prunus persicappa005538mppa004914mppa004491mppa005995mppa004625m
ppa004627m
Ricinus communis29840.m00061530128.m00872829818.m00039330138.m00407929717.m000231
30073.m002257
Setaria italicaSi025194mSi001454mSi029615mSi015706mSi001155m
Si026308mSi010016mSi035588mSi002120m
Selaginella moellendorffii147086857471076759836299588
418827.96.275418827.96.275418827.290.358418827.290.358
Sorghum bicolorSb01g036720.1Sb02g036640.1Sb03g044100.1Sb08g001860.2Sb08g001860.1
Sb03g037670.1Sb07g021480.1Sb06g032380.1
Thellungiella halophilaThhalv10016654mThhalv10000882mThhalv10007515mThhalv10018590mThhalv10018515m
Thhalv10020580mThhalv10002514mThhalv10020554mThhalv10013266m
Vitis viniferaGSVIVT01012106001GSVIVT01014123001GSVIVT01008002001GSVIVT01029936001GSVIVT01036850001
GSVIVT01010454001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)