y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00058096m
FamilyGT58
Protein PropertiesLength: 427 Molecular Weight: 48407.9 Isoelectric Point: 9.9913
ChromosomeChromosome/Scaffold: 020146 Start: 1853 End: 5777
Descriptionasparagine-linked glycosylation 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT58353980
  ALLVLANAALVVLIIAFVPYTKIDWDAYMSQVDAFLEGGRDYTKIEGDTGPLVYPAGFLYVYSAIKFLTGGQVFPAQILFGVLYIVNLCLVLLLYVKTEV
  LPWWALGLLCLSKRVHSIFVLRLFNDCFAMTLLHAAMVLIIYHKWYLGLIVFSGAVSVKMNVLLFAPSLLLLMVKSISIKGVFFALFGAAVVQVLLGMPF
  LLSHPVEYISRAFNLGRVFIHFWSVNFKFVPEKLFVSKELAIALLILHLTTLMVFAHYKWLKHEGGLFSLLHSRFKHAKSIVQLFSSKPRPSILSKEHIV
  TVMFVGNFIGIVCARSLHYQFYSWYFYSLPFLLWKTHFPTPLRIIIFLGVELCWNIYPSTAYSS
Full Sequence
Protein Sequence     Length: 427     Download
MARAEKKRAA RTATATAAVE RPSGTSDRRP LYFAALLVLA NAALVVLIIA FVPYTKIDWD    60
AYMSQVDAFL EGGRDYTKIE GDTGPLVYPA GFLYVYSAIK FLTGGQVFPA QILFGVLYIV    120
NLCLVLLLYV KTEVLPWWAL GLLCLSKRVH SIFVLRLFND CFAMTLLHAA MVLIIYHKWY    180
LGLIVFSGAV SVKMNVLLFA PSLLLLMVKS ISIKGVFFAL FGAAVVQVLL GMPFLLSHPV    240
EYISRAFNLG RVFIHFWSVN FKFVPEKLFV SKELAIALLI LHLTTLMVFA HYKWLKHEGG    300
LFSLLHSRFK HAKSIVQLFS SKPRPSILSK EHIVTVMFVG NFIGIVCARS LHYQFYSWYF    360
YSLPFLLWKT HFPTPLRIII FLGVELCWNI YPSTAYSSLL LLFLHISVLL GIWFSPTEYP    420
YIDKRT*                                                              480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05208ALG32.0e-12953394348+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF84701.1014261431unknown [Zea mays]
GenBankEAY72720.10213849372hypothetical protein OsI_00584 [Oryza sativa Indica Group]
GenBankEAZ10720.10213849372hypothetical protein OsJ_00555 [Oryza sativa Japonica Group]
RefSeqNP_001143883.1014261431hypothetical protein LOC100276684 [Zea mays]
RefSeqXP_002455106.1014261424hypothetical protein SORBIDRAFT_03g004440 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5466EC-2.4.1.258Dol-P-Man:Man5GlcNAc2-PP-Dol α-1,3-mannosyltransferase
Transmembrane Domains
StartEnd
3153
107129
152174
184206
215237
242261
268290
332351
358380
395417
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT046057324623850
JG9008392421313720
DR736742286853700
HS3529202441844270
JG90083938771140.00000000000008
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00758.1Aquca_003_00758.2Aquca_003_00758.3
Arabidopsis lyrata904250
Arabidopsis thalianaAT2G47760.3AT2G47760.1AT2G47760.2
Brachypodium distachyonBradi2g04440.1
Brassica rapaBra000461.29.139Bra004431
Carica papayaevm.model.supercontig_9.209
Capsella rubellaCarubv10023173m
Citrus clementinaCiclev10020260m
Citrus sinensisorange1.1g014346morange1.1g015618m.102.369orange1.1g015618m.102.369orange1.1g015618m.30.104orange1.1g015618m.30.104
Cucumis sativusCucsa.205720.1
Eucalyptus grandisEucgr.H01160.1
Fragaria vescamrna10569.1-v1.0-hybrid
Glycine maxGlyma19g39740.1Glyma03g37130.1
Gossypium raimondiiGorai.008G011100.2Gorai.008G011100.1
Linum usitatissimumLus10031921Lus10035085
Malus domesticaMDP0000161757
Manihot esculentacassava4.1_008035m
Medicago truncatulaMedtr7g108620.1
Mimulus guttatusmgv1a006267mmgv1a008112m
Oryza sativaLOC_Os01g07720.4LOC_Os01g07720.2
Panicum virgatumPavirv00012164m
Physcomitrella patensPp1s58_150V6.1
Phaseolus vulgarisPhvul.001G205800.1
Picea abiesMA_10426799g0010
Populus trichocarpaPotri.014G131600.2Potri.014G131600.1Potri.014G131600.3
Prunus persicappa005841m
Ricinus communis30129.m000370
Setaria italicaSi001564m
Selaginella moellendorffii96090
Sorghum bicolorSb03g004440.1
Thellungiella halophilaThhalv10001458m
Vitis viniferaGSVIVT01027976001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny