y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00059046m
FamilyCBM43
Protein PropertiesLength: 467 Molecular Weight: 50211.2 Isoelectric Point: 8.5704
ChromosomeChromosome/Scaffold: 0201174 Start: 584 End: 2245
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433864671.5e-25
  WCVVSAAASKKRNETAVGNALSYACGQGNGTCDAIQPGKQCYLPNTTVAHASYAFNSYWQQFRKIGATCYFNNLAEQTIEDP
GH17353590
  LGVNYGRVADDIPSPRRSVELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNEIIPDIAASPAAAGRWVADNLVPYYPATRVKFLLVGNEILSDYS
  IVNSTWTRLVPAMENIHLSLRKRGISSVKIGTTLAMDALADGAFPRPPSAAAFRPDIAESVVRPLLHFLNGTNSYYFVDAYPYFVWAGNNLTVSLDYALF
  QGGRTRYVDPGTGLTYTNMLDEMLDAVAIAMAKLGYGGVKLAVAETGWPNGCDFDQIGGNVHNAAIYNRNLAARMAKNPGTPLRPGAKMPVFVFSLYNED
  LKGGPGTERHWGLYYANGTAVYEID
Full Sequence
Protein Sequence     Length: 467     Download
MAAAPPLRAL LLLLCTAFSV HVAAAHGASA GGHGLGVNYG RVADDIPSPR RSVELLRAAG    60
AGSVKIYDAN PGVLRALAGT RWPVSIMVPN EIIPDIAASP AAAGRWVADN LVPYYPATRV    120
KFLLVGNEIL SDYSIVNSTW TRLVPAMENI HLSLRKRGIS SVKIGTTLAM DALADGAFPR    180
PPSAAAFRPD IAESVVRPLL HFLNGTNSYY FVDAYPYFVW AGNNLTVSLD YALFQGGRTR    240
YVDPGTGLTY TNMLDEMLDA VAIAMAKLGY GGVKLAVAET GWPNGCDFDQ IGGNVHNAAI    300
YNRNLAARMA KNPGTPLRPG AKMPVFVFSL YNEDLKGGPG TERHWGLYYA NGTAVYEIDL    360
TGRRPLWSYP PLPAPENNTP YKGPIWCVVS AAASKKRNET AVGNALSYAC GQGNGTCDAI    420
QPGKQCYLPN TTVAHASYAF NSYWQQFRKI GATCYFNNLA EQTIEDP                  480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53090.000927135184+
pfam07983X82.0e-1738646080+
smart00768X86.0e-3038646782+
pfam00332Glyco_hydro_171.0e-8038359323+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN28576.101474671321unknown [Zea mays]
GenBankEEC84834.1094675465hypothetical protein OsI_31928 [Oryza sativa Indica Group]
RefSeqNP_001063586.10104678468Os09g0502200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001149815.101946718465glucan endo-1,3-beta-glucosidase A6 [Zea mays]
RefSeqXP_002462618.103546737469hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0353601312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghs_B0353601306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0353601306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghr_A0353601306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1aq0_B0353601306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC9045942781053820
EE1582982691053730
DV5091242711193890
EE0439692621053660
EE0457692611143740
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)