| Basic Information | |
|---|---|
| Species | Panicum virgatum |
| Cazyme ID | Pavirv00060284m |
| Family | GH1 |
| Protein Properties | Length: 111 Molecular Weight: 12137.7 Isoelectric Point: 5.1106 |
| Chromosome | Chromosome/Scaffold: 0150280 Start: 1560 End: 2683 |
| Description | beta glucosidase 42 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 11 | 110 | 3.7e-31 |
| DYFALYAEACFANFGDRVKCWMTLNEPLQTAFNGYGIGVFAPGGCEGETARCYLAAHHQILAHAAAVDVYRRKFKAAQGGEVGLVVDCEWAEPFSEKAED | |||
| Full Sequence |
|---|
| Protein Sequence Length: 111 Download |
| MSFSPSKYPR DYFALYAEAC FANFGDRVKC WMTLNEPLQT AFNGYGIGVF APGGCEGETA 60 RCYLAAHHQI LAHAAAVDVY RRKFKAAQGG EVGLVVDCEW AEPFSEKAED * 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02849 | PLN02849 | 4.0e-9 | 13 | 94 | 91 | + beta-glucosidase | ||
| PRK13511 | PRK13511 | 1.0e-9 | 11 | 95 | 85 | + 6-phospho-beta-galactosidase; Provisional | ||
| COG2723 | BglB | 1.0e-14 | 11 | 110 | 100 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| TIGR03356 | BGL | 2.0e-20 | 11 | 110 | 100 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 7.0e-25 | 11 | 110 | 100 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI23349.1 | 5.60519e-45 | 12 | 110 | 8 | 106 | unnamed protein product [Vitis vinifera] |
| GenBank | EEC71957.1 | 0 | 11 | 110 | 152 | 251 | hypothetical protein OsI_04787 [Oryza sativa Indica Group] |
| RefSeq | NP_001045089.1 | 0 | 11 | 110 | 152 | 251 | Os01g0897600 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001146483.1 | 0 | 11 | 110 | 152 | 251 | hypothetical protein LOC100280071 [Zea mays] |
| RefSeq | XP_002456785.1 | 0 | 11 | 110 | 277 | 376 | hypothetical protein SORBIDRAFT_03g042690 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3gnr_A | 2e-26 | 11 | 110 | 153 | 262 | A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity |
| PDB | 3gnp_A | 2e-26 | 11 | 110 | 153 | 262 | A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity |
| PDB | 3gno_A | 2e-26 | 11 | 110 | 153 | 262 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 2jf7_B | 3e-24 | 11 | 110 | 182 | 286 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 2jf7_A | 3e-24 | 11 | 110 | 182 | 286 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FL979566 | 111 | 1 | 111 | 0 |
| FL894806 | 110 | 1 | 110 | 0 |
| JG798933 | 100 | 11 | 110 | 0 |
| FL941980 | 100 | 11 | 110 | 0 |
| BE361086 | 100 | 11 | 110 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |