CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00061210m
FamilyGH28
Protein PropertiesLength: 463 Molecular Weight: 50624.6 Isoelectric Point: 7.8882
ChromosomeChromosome/Scaffold: 002057 Start: 7044 End: 9299
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28563870
  VDACAAAGGGRVLLPAPGDYLTATVHLRSRVVLEVAPGARLLGGTRQADYPPESRRWYVVLAENTTGAGITGGGEINGQGEAFVVTPSEVKNVMVSWNAT
  GDCLGDECRPRLVGFIDSKDVRIHDITLNQPAYWCLHLVRCDNTVIRNVSIFGDFKSPNNDGIDITDSNNTVITDCHIDTGDDALCPKSSTGPVYNLTAT
  NCWIRTKSCAIKFGSASYFNFNKLVFNNITIVDSHRGLGMQIRDGGNVSDVLFSNIKMSTRYYHPLWWGRAEPIYITTCPRHPDSKEGTISDIRFINISS
  VSENGVFLAGSKHGLLRNLKFKNVDLTYKRWT
Full Sequence
Protein Sequence     Length: 463     Download
MASPPLQFAA PPLLLLLVLL AVAVPAARSS RVFSVADYGA VGDGSRYDTA AIQAAVDACA    60
AAGGGRVLLP APGDYLTATV HLRSRVVLEV APGARLLGGT RQADYPPESR RWYVVLAENT    120
TGAGITGGGE INGQGEAFVV TPSEVKNVMV SWNATGDCLG DECRPRLVGF IDSKDVRIHD    180
ITLNQPAYWC LHLVRCDNTV IRNVSIFGDF KSPNNDGIDI TDSNNTVITD CHIDTGDDAL    240
CPKSSTGPVY NLTATNCWIR TKSCAIKFGS ASYFNFNKLV FNNITIVDSH RGLGMQIRDG    300
GNVSDVLFSN IKMSTRYYHP LWWGRAEPIY ITTCPRHPDS KEGTISDIRF INISSVSENG    360
VFLAGSKHGL LRNLKFKNVD LTYKRWTNYT GGLYDYRPGC EKMVKHKTGG MMVEHVSGLE    420
IDNVRMRWAR GSLKGWDVNP ILFRPSTIDK LSFHDWQSVD VQ* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03003PLN030033.0e-8164310197+
PLN03010PLN030102.0e-819625762+
PLN02188PLN021886.0e-9165384236+
pfam00295Glyco_hydro_286.0e-16165383238+
COG5434PGU14.0e-3137314312+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC84787.103146125455hypothetical protein OsI_31840 [Oryza sativa Indica Group]
GenBankEEE69946.103146125454hypothetical protein OsJ_29824 [Oryza sativa Japonica Group]
RefSeqNP_001063526.103146125450Os09g0487600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148969.102646221457polygalacturonase [Zea mays]
RefSeqXP_002462564.103146231462hypothetical protein SORBIDRAFT_02g028280 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3jur_D2e-173130826343A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_C2e-173130826343A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_B2e-173130826343A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_A2e-173130826343A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB2uvf_B0.00000000000431247155412A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
Signal Peptide
Cleavage Site
29
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB6788562701544230
GT8323882572074630
BQ5788702501674160
FL7358422332314630
CB6788572412224620
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00836.1
Arabidopsis lyrata324272
Arabidopsis thalianaAT3G57790.1
Brachypodium distachyonBradi4g33660.1
Brassica rapaBra035299
Carica papayaevm.TU.contig_34124.1
Capsella rubellaCarubv10019007m
Chlamydomonas reinhardtiiCre12.g556350.t1.3
Citrus clementinaCiclev10005155mCiclev10004869m
Citrus sinensisorange1.1g038762m
Cucumis sativusCucsa.242950.1
Eucalyptus grandisEucgr.K01816.4Eucgr.K01816.1Eucgr.K01816.3Eucgr.K01816.2
Fragaria vescamrna00558.1-v1.0-hybrid
Glycine maxGlyma19g32550.1
Gossypium raimondiiGorai.006G139700.1
Linum usitatissimumLus10026318Lus10042350
Malus domesticaMDP0000248311
Manihot esculentacassava4.1_024146m
Medicago truncatulaMedtr7g092470.1
Mimulus guttatusmgv1a005515m
Oryza sativaLOC_Os09g31270.1
Panicum virgatumPavirv00068607m
Physcomitrella patensPp1s116_9V6.1Pp1s375_23V6.1
Phaseolus vulgarisPhvul.001G138000.1
Populus trichocarpaPotri.016G051200.1
Prunus persicappa005960m
Ricinus communis27810.m000670
Setaria italicaSi029777m
Selaginella moellendorffii437695105243
Sorghum bicolorSb02g028280.1
Thellungiella halophilaThhalv10005936m
Vitis viniferaGSVIVT01033349001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny