CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00061483m
FamilyGH13
Protein PropertiesLength: 754 Molecular Weight: 85971.5 Isoelectric Point: 6.1768
ChromosomeChromosome/Scaffold: 001305 Start: 7152 End: 14092
Descriptionstarch branching enzyme 2.2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132075325.2e-26
  LPRIRANNYNTVQLMAVMEHSYYASFGYHVTNFFAVSSRSGTPEDLKYLVDKAHSLGLRVLMDVVHSHASNNVTDGLNGYDVGQSTQESYFHTGDRGYHK
  LWDSRLFNYANWEVLRFLLSNLRYLMDEFMFDGFRFDGVTSMLYHHHGINVGFTGNYKEYFSLDTDVDAVVYMMLANHLMHKILPEATVVAEDVSGMPVL
  CRPVDEGGVGFDYRLAMAIPDRWIDYLKNKEDSEWSMGEIAHTLTNRRYTEKCIAYAESHDQSIVGDKTIAFLLMDKEMYTGMSDLQPASPTIDRGIALQ
  KMIHFITMALGGDGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 754     Download
MAASQDDVDH LPIYKLDPDL EKFKDHFSYR MKRYLDQKCS IEKNEGSLEE FSKGYLKYGI    60
NTNKDATVYR EWAPAAQEAQ LIGDFNDWNG ANHQMEKDKF GVWSIKIDHV KGKPAIPHNS    120
RVKFRFRHGG VWVDRIPAWI RYATVDASKF GAPYDGVHWD PPASERYMFK HPRPSKPVAP    180
RIYEAHVGMS GEKPAVSTYR EFADNVLPRI RANNYNTVQL MAVMEHSYYA SFGYHVTNFF    240
AVSSRSGTPE DLKYLVDKAH SLGLRVLMDV VHSHASNNVT DGLNGYDVGQ STQESYFHTG    300
DRGYHKLWDS RLFNYANWEV LRFLLSNLRY LMDEFMFDGF RFDGVTSMLY HHHGINVGFT    360
GNYKEYFSLD TDVDAVVYMM LANHLMHKIL PEATVVAEDV SGMPVLCRPV DEGGVGFDYR    420
LAMAIPDRWI DYLKNKEDSE WSMGEIAHTL TNRRYTEKCI AYAESHDQSI VGDKTIAFLL    480
MDKEMYTGMS DLQPASPTID RGIALQKMIH FITMALGGDG YLNFMGNEFG HPEWIDFPRE    540
GNNWSYDKCR RQWSLVDTDH LRYKYMNAFD QAMNALDEEF SFLSSPKQIV SDMNEEKKVI    600
VFERGDLVFV FNFHPKNTYD GYKVGCDLPG KYRVALDSDA FVFGGHGRVG HDVDHFTSPE    660
GVPGVPETNF NNRPNSFKVL SPPRTCVAYY RVDEEAETTG AGKTSPEIID VDATTLKTPT    720
ATTEACEERE STEDVSGKKG RKFGRQSSDK STK* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029605.0e-63010885+
PLN03244PLN032448.0e-134114639528+
PLN02960PLN029602.0e-179114639527+
PLN02447PLN0244701697698+
cd11321AmyAc_bac_euk_BE0164571408+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD50279.20175373832seed starch branching enzyme [Sorghum bicolor]
GenBankAAO20100.10175373823starch branching enzyme I [Zea mays]
GenBankABQ15209.10175373823starch branching enzyme I [Zea mays]
DDBJBAA01854.10175372822branching enzyme-I precursor [Zea mays]
RefSeqNP_001105370.10175373823starch branching enzyme1 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3aml_A017531755A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B016971698A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A016971698A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3amk_A016971698A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB1m7x_D2e-396664526577A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO619167610977010
HO794536717137100
HO777638664667100
CX1091874523097540
HO4581234013006890
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)