CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00063957m
FamilyGH13
Protein PropertiesLength: 455 Molecular Weight: 50011.4 Isoelectric Point: 6.0561
ChromosomeChromosome/Scaffold: 022923 Start: 2201 End: 8048
Descriptionisoamylase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132474248.3e-34
  VRGSYLGLIDKIPHLLELGVNAVELLPVFEFDELEFKRFPNPRDHMVNTWGYSTINFFAPMSRYASAGGGPVAASKELKQMVKALHNAGIEVILDVVYNH
  TNEADDANPYMTSFRGIDNKVYYMLDLNNNPQLLNFSGCGNTLNCNHPVVKELVLDSLRHWVKEYHIDGFRFDLASVL
Full Sequence
Protein Sequence     Length: 455     Download
MDSVGTNRSP LRSAAAAAAP ATRSSALPRP HRHPALGNRF DAARSTMARA QSGKAARSVI    60
REMGHTASDS EMPLKYSSGK AFPLGVSQAD GGLNFAIFSQ HASSVTLCLK LPERGTQNDA    120
EIVEFALDRQ KNKTGDIWHV SVEGLPASGV LYGYRINGPQ GWQQGHRFDD SVILLDPYAK    180
LVSGRKYFGV DKEEPSQFFG TYDFDSSPFD WGDDYRLPNL PESDLVIYEM NVRAFTADES    240
SGLVPAVRGS YLGLIDKIPH LLELGVNAVE LLPVFEFDEL EFKRFPNPRD HMVNTWGYST    300
INFFAPMSRY ASAGGGPVAA SKELKQMVKA LHNAGIEVIL DVVYNHTNEA DDANPYMTSF    360
RGIDNKVYYM LDLNNNPQLL NFSGCGNTLN CNHPVVKELV LDSLRHWVKE YHIDGFRFDL    420
ASVLCRGPDG SPLDAPPLIK PLQPLSWSLT SEAP* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145107.0e-6973444386+
PRK03705PRK037052.0e-8678436382+
TIGR02100glgX_debranch2.0e-11578430372+
COG1523PulA7.0e-11870436388+
cd11326AmyAc_Glg_debranch4.0e-123209440235+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD19754.10594421386putative isoamylase-type starch debranching enzyme [Oryza sativa Japonica Group]
DDBJBAD89532.1014421462isoamylase [Hordeum vulgare]
EMBLCBI19205.104044258462unnamed protein product [Vitis vinifera]
GenBankEEE69882.1014421468hypothetical protein OsJ_29702 [Oryza sativa Japonica Group]
RefSeqNP_001105198.10634421380isoamylase-type starch debranching enzyme ISO3 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B07942615370A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2vuy_A07942615370A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2vr5_B07942615370A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2vr5_A07942615370A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2vnc_B07942615370A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12280EC-3.2.1.68isoamylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8398053181254420
FL809354233432750
HO7987252721714420
EV5364332631764380
FL809354712413110.0000000000004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)