Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00065452m |
Family | CBM43 |
Protein Properties | Length: 85 Molecular Weight: 8671.43 Isoelectric Point: 4.2173 |
Chromosome | Chromosome/Scaffold: 0119210 Start: 1 End: 907 |
Description | O-Glycosyl hydrolases family 17 protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 2 | 77 | 2e-30 |
ASDAELQADLDYACAQVGVDCGAIQPGGACFEPNTVRAHAAYAINQLYQAAGRHPWNCDFRASATLTSDNPSYGAC |
Full Sequence |
---|
Protein Sequence Length: 85 Download |
GASDAELQAD LDYACAQVGV DCGAIQPGGA CFEPNTVRAH AAYAINQLYQ AAGRHPWNCD 60 FRASATLTSD NPSYGACVYT GGGQ* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 2.0e-13 | 1 | 66 | 71 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 9.0e-30 | 1 | 79 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACN26761.1 | 0 | 1 | 84 | 240 | 323 | unknown [Zea mays] |
RefSeq | NP_001050864.1 | 0 | 1 | 82 | 382 | 463 | Os03g0669300 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001141090.1 | 0 | 1 | 84 | 241 | 324 | hypothetical protein LOC100273173 [Zea mays] |
RefSeq | NP_001148381.1 | 0 | 1 | 84 | 378 | 461 | glucan endo-1,3-beta-glucosidase 7 [Zea mays] |
RefSeq | XP_002466692.1 | 0 | 1 | 84 | 392 | 475 | hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-33 | 1 | 82 | 19 | 99 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FL820069 | 85 | 1 | 85 | 0 |
FL886138 | 85 | 1 | 85 | 0 |
FL751078 | 85 | 1 | 85 | 0 |
FL705181 | 85 | 1 | 85 | 0 |
FL911119 | 85 | 1 | 85 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|