Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00066262m |
Family | GH32 |
Protein Properties | Length: 167 Molecular Weight: 18670.4 Isoelectric Point: 11.8012 |
Chromosome | Chromosome/Scaffold: 0119992 Start: 749 End: 2446 |
Description | cell wall invertase 4 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH32 | 52 | 124 | 6.8e-33 |
HFQPRKNWINDPNAPLYYKGWYHIFYQYNPKGAVWGNIVWGHSVSRDLINWVALKPALEPSIPSTGTAAGRAR |
Full Sequence |
---|
Protein Sequence Length: 167 Download |
MRGLGRVVWA WLLLLQLAGA SHVVYENLLE VEAAAAAVPP SIVDPLLRTG YHFQPRKNWI 60 NDPNAPLYYK GWYHIFYQYN PKGAVWGNIV WGHSVSRDLI NWVALKPALE PSIPSTGTAA 120 GRARRRRCPT ARRRSCTRAS TARTSTTRSR TWPTRGTRRT RCSGSG* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
TIGR01322 | scrB_fam | 1.0e-19 | 48 | 112 | 65 | + sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]. |
COG1621 | SacC | 3.0e-23 | 41 | 112 | 72 | + Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism] |
cd08996 | GH32_B_Fructosidase | 9.0e-25 | 58 | 112 | 55 | + Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. |
smart00640 | Glyco_32 | 8.0e-34 | 52 | 112 | 61 | + Glycosyl hydrolases family 32. |
pfam00251 | Glyco_hydro_32N | 5.0e-35 | 52 | 112 | 61 | + Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAQ24868.1 | 0 | 6 | 113 | 7 | 120 | cell wall invertase 2 [Oryza sativa Indica Group] |
GenBank | ACG47298.1 | 0 | 18 | 114 | 21 | 120 | beta-fructofuranosidase, insoluble isoenzyme 2 precursor [Zea mays] |
RefSeq | NP_001052748.1 | 0 | 6 | 113 | 7 | 120 | Os04g0413500 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001151535.1 | 0 | 19 | 115 | 20 | 115 | beta-fructofuranosidase, insoluble isoenzyme 2 [Zea mays] |
Swiss-Prot | Q01IS7 | 0 | 6 | 113 | 7 | 120 | INV2_ORYSI RecName: Full=Beta-fructofuranosidase, insoluble isoenzyme 2; AltName: Full=Sucrose hydrolase 2; AltName: Full=Invertase 2; AltName: Full=Cell wall beta-fructosidase 2; AltName: Full=OsCIN2; Flags: Precursor |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2ac1_A | 1e-29 | 40 | 114 | 2 | 75 | A Chain A, Crystal Structure Of A Cell-Wall Invertase From Arabidopsis Thaliana |
PDB | 2xqr_K | 5e-29 | 48 | 114 | 5 | 71 | B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor |
PDB | 2xqr_I | 5e-29 | 48 | 114 | 5 | 71 | B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor |
PDB | 2xqr_G | 5e-29 | 48 | 114 | 5 | 71 | B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor |
PDB | 2xqr_E | 5e-29 | 48 | 114 | 5 | 71 | B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
sucrose degradation III | RXN-1461 | EC-3.2.1.26 | β-fructofuranosidase |