y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00066351m
FamilyCBM43
Protein PropertiesLength: 479 Molecular Weight: 51373.6 Isoelectric Point: 8.5554
ChromosomeChromosome/Scaffold: 012246 Start: 4210 End: 5930
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433894711.5e-26
  WCVMSPAASKKLNETAVGNALSYACGQGNGTCDAIQPGKKCYLPNTTVAHASYAFNSYWQQFRRTGATCYFNNLAEQTIKDPI
GH17383620
  LGVNYGRVADDIPSPRRSVELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNEIIPDIAASPAAADRWVADNLVPYYPATRVKFLLVGNEILSDYS
  IANSTWARLVPAMENIHLSLRKRGISSVKIGTTLAMDALADGAFPRPPSAAAFRPDIAGSVVRPLLHFLNGTNSYYFVDAYPYFVWAGNNLTVPLDYALF
  QGGRTRYVDPGTGLTYTNLLDEMLDAVAIAMAKLGYGGVKLAVAETGWPNGCDYDQIGGNVHNAAIYNRNLAARMAKNPGTPLRPGAKMPVFVFSLYNED
  LKGGPGTERHWGLYYANGTAVYEVD
Full Sequence
Protein Sequence     Length: 479     Download
MAAAQPPRAL PLLLLLLCAA FSFHVEAAHG ASGGAHGLGV NYGRVADDIP SPRRSVELLR    60
AAGAGSVKIY DANPGVLRAL AGTRWPVSIM VPNEIIPDIA ASPAAADRWV ADNLVPYYPA    120
TRVKFLLVGN EILSDYSIAN STWARLVPAM ENIHLSLRKR GISSVKIGTT LAMDALADGA    180
FPRPPSAAAF RPDIAGSVVR PLLHFLNGTN SYYFVDAYPY FVWAGNNLTV PLDYALFQGG    240
RTRYVDPGTG LTYTNLLDEM LDAVAIAMAK LGYGGVKLAV AETGWPNGCD YDQIGGNVHN    300
AAIYNRNLAA RMAKNPGTPL RPGAKMPVFV FSLYNEDLKG GPGTERHWGL YYANGTAVYE    360
VDLTGRRPLC SYPPLPAPEN NTPYKGPIWC VMSPAASKKL NETAVGNALS YACGQGNGTC    420
DAIQPGKKCY LPNTTVAHAS YAFNSYWQQF RRTGATCYFN NLAEQTIKDP ISICNSFN*     480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53090.000327435484+
pfam07983X87.0e-1838946380+
smart00768X82.0e-3038947082+
pfam00332Glyco_hydro_173.0e-8238362326+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN28576.101504701321unknown [Zea mays]
GenBankEEC84834.10144707465hypothetical protein OsI_31928 [Oryza sativa Indica Group]
RefSeqNP_001063586.10124707468Os09g0502200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001149815.101847016465glucan endo-1,3-beta-glucosidase A6 [Zea mays]
RefSeqXP_002462618.103847037469hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ghr_A0383631306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1aq0_B0383631306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1aq0_A0383631306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB3ur8_B0383643315A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB3ur8_A0383643315A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC9045942781083850
EE1582982691083760
DV5091242711223920
EE0439692621083690
EE0457692611173770
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)