y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPanicum virgatum
Cazyme IDPavirv00069200m
FamilyGT47
Protein PropertiesLength: 419 Molecular Weight: 47277.4 Isoelectric Point: 7.1526
ChromosomeChromosome/Scaffold: 009012 Start: 9485 End: 13080
DescriptionExostosin family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47513460
  KLKVFVYEMPRKYNQMLLSKDSRCLHHMFAAEIFTHQFLLSSAVRTLDPEEADWFYTPVYTTCDLTPQGFPLPFRAPRIMRSAVKYVATTWPYWNRTEGA
  DHFFLTPHDFGACFHYQEERAMERGILPLLRRATLVQTFGQRNHVCLQEGSITIPPYANPHKMQAHLINPGTPRSIFVYFRGLFYDMGNDPEGGYYARGA
  RASVWENFKDNPLFDISTEHPSTYYEDMQRAIFCLCPLGWAPWSPRLVEAVVFGCIPVIIADDIVLPFADAIPWEQISVFVAERDVPRLDSILTSI
Full Sequence
Protein Sequence     Length: 419     Download
MGRERRPWPA AAAAVLLLVA SCVAAAPLQQ HQRARITGDA GGVLDDNPVG KLKVFVYEMP    60
RKYNQMLLSK DSRCLHHMFA AEIFTHQFLL SSAVRTLDPE EADWFYTPVY TTCDLTPQGF    120
PLPFRAPRIM RSAVKYVATT WPYWNRTEGA DHFFLTPHDF GACFHYQEER AMERGILPLL    180
RRATLVQTFG QRNHVCLQEG SITIPPYANP HKMQAHLINP GTPRSIFVYF RGLFYDMGND    240
PEGGYYARGA RASVWENFKD NPLFDISTEH PSTYYEDMQR AIFCLCPLGW APWSPRLVEA    300
VVFGCIPVII ADDIVLPFAD AIPWEQISVF VAERDVPRLD SILTSIPLQD ILRKQRLLAG    360
ASVKQALLFH QPARPGDAFD QILNGLARKL PHGKGVFLQP GEKVLDWDAG LESDLKPW*     420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin2.0e-8151346304+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG43504.103041832420secondary cell wall-related glycosyltransferase family 47 [Zea mays]
GenBankACN31576.10134186412unknown [Zea mays]
GenBankACR34554.10134186412unknown [Zea mays]
RefSeqNP_001045262.103141835422Os01g0926400 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002459015.10114186415hypothetical protein SORBIDRAFT_03g044510 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
xylogalacturonan biosynthesisRXN-9589EC-2.4.2.41xylogalacturonan β-1,3-xylosyltransferase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO868810331643940
GO846508325954190
GO872051326613860
FL823261265553190
GO871901312463570
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00048.1Aquca_009_00245.1Aquca_038_00127.1Aquca_025_00369.1Aquca_038_00127.2
Arabidopsis lyrata486213489149496352481698906539
472948904882
Arabidopsis thalianaAT5G22940.1AT3G57630.2AT3G57630.1AT5G61840.1AT2G28110.1
AT1G27440.1
Brachypodium distachyonBradi1g73000.1Bradi1g78027.1Bradi3g32610.1Bradi2g59400.1Bradi3g44420.1
Bradi2g59410.1Bradi2g59380.1Bradi5g08400.1
Brassica rapaBra007343Bra006644Bra002442Bra011977Bra034389
Bra030051Bra019618Bra010940Bra020202Bra010938
Carica papayaevm.model.supercontig_92.12evm.model.supercontig_92.13evm.model.supercontig_13.182evm.model.supercontig_38.66evm.model.supercontig_1.13
Capsella rubellaCarubv10016706mCarubv10001248mCarubv10023203mCarubv10026485mCarubv10009184m
Chlamydomonas reinhardtiiCre17.g721750.t1.3g6238.t1Cre03.g204050.t1.3g6362.t1Cre14.g619854.t1.2
Cre07.g325050.t1.3Cre03.g204100.t1.3Cre03.g157000.t1.3g6237.t1g10273.t1
Cre09.g390750.t1.2Cre06.g311950.t1.3Cre09.g417250.t1.2g11590.t1Cre09.g414750.t1.3
Cre03.g205250.t1.3Cre12.g561050.t1.3Cre10.g430100.t1.3Cre02.g144100.t1.2Cre03.g202550.t1.3
Cre02.g116600.t2.1Cre02.g116600.t1.2Cre02.g144050.t2.1Cre02.g144050.t1.2g13296.t1.158.456
g13296.t1.158.456g13296.t1.158.456Cre10.g430250.t1.2Cre11.g483400.t1.3Cre05.g233450.t1.2
g4741.t1Cre02.g111150.t1.3Cre13.g577400.t1.3g9003.t1g9612.t1
g13296.t1.786.965g13296.t1.786.965g13296.t1.786.965Cre13.g577050.t1.3Cre12.g502500.t1.2
Cre12.g502450.t1.3g9878.t1Cre14.g622050.t1.3Cre04.g211950.t1.3Cre02.g099400.t1.3
Citrus clementinaCiclev10004353mCiclev10031659mCiclev10028404mCiclev10005075mCiclev10005354m
Ciclev10028817mCiclev10029035m
Citrus sinensisorange1.1g003853morange1.1g005688morange1.1g005509morange1.1g008406morange1.1g048016m
orange1.1g038885m
Cucumis sativusCucsa.336860.1Cucsa.385750.1Cucsa.207490.1Cucsa.095760.1Cucsa.156870.1
Cucsa.156870.2
Eucalyptus grandisEucgr.A02396.1Eucgr.K02191.1Eucgr.G01977.1Eucgr.J00384.1
Fragaria vescamrna26458.1-v1.0-hybridmrna33411.1-v1.0-hybridmrna24598.1-v1.0-hybrid
Glycine maxGlyma10g21710.2Glyma03g29570.1Glyma02g31340.1Glyma10g21710.1Glyma12g30210.2
Glyma12g30210.1Glyma13g39700.1Glyma12g08530.6Glyma12g08530.5Glyma12g08530.4
Glyma12g08530.3Glyma12g08530.2Glyma06g17140.1Glyma04g37920.1Glyma05g33420.1
Glyma11g19910.1
Gossypium raimondiiGorai.006G138400.1Gorai.006G138400.2Gorai.008G156000.1Gorai.009G111000.1Gorai.005G197500.1
Gorai.013G269400.2Gorai.013G269400.1Gorai.008G211000.1Gorai.008G211000.2
Linum usitatissimumLus10042357Lus10026311Lus10043326Lus10019479Lus10041343
Lus10037376Lus10043209Lus10032530
Malus domesticaMDP0000086882MDP0000311272MDP0000817103MDP0000226874MDP0000316785
MDP0000840668MDP0000206089MDP0000121803
Manihot esculentacassava4.1_010254mcassava4.1_007156mcassava4.1_024144mcassava4.1_008638mcassava4.1_008504m
cassava4.1_013685mcassava4.1_026806mcassava4.1_011607m
Medicago truncatulaMedtr4g057500.1
Mimulus guttatusmgv1a006381mmgv1a006282mmgv1a007187mmgv1a007172mmgv1a010214m
Oryza sativaLOC_Os03g01760.1LOC_Os03g07820.1LOC_Os01g70190.1LOC_Os01g70180.2LOC_Os01g70180.1
LOC_Os03g01760.2LOC_Os01g70200.1LOC_Os02g32110.1LOC_Os04g32670.1LOC_Os10g10080.2
LOC_Os10g10080.1LOC_Os10g10080.3
Panicum virgatumPavirv00003745mPavirv00003744mPavirv00054799mPavirv00015202mPavirv00009677m
Pavirv00041618mPavirv00048254mPavirv00000313mPavirv00004838mPavirv00017278m
Pavirv00059316m.13.129Pavirv00059316m.13.129Pavirv00013783mPavirv00048255mPavirv00004837m
Pavirv00031734mPavirv00024113mPavirv00024114mPavirv00023354mPavirv00021477m
Pavirv00038110mPavirv00054608mPavirv00059316m.131.264Pavirv00059316m.131.264
Physcomitrella patensPp1s217_58V6.2Pp1s217_58V6.1Pp1s13_216V6.1Pp1s110_97V6.1Pp1s315_20V6.1
Pp1s7_455V6.1
Phaseolus vulgarisPhvul.007G255200.1Phvul.005G130800.1Phvul.011G085300.1Phvul.002G281100.1Phvul.009G160700.1
Picea abiesMA_10429529g0010MA_10436102g0010MA_18829g0010
Populus trichocarpaPotri.006G054800.1Potri.012G109600.1Potri.009G006500.1Potri.003G162000.1Potri.001G068100.2
Potri.001G068100.1Potri.012G109200.1Potri.015G116700.1Potri.001G068100.3Potri.015G116700.2
Prunus persicappa001595mppa005437mppa006418mppa008207m
Ricinus communis27810.m00064429589.m00124730147.m01439730128.m00856530128.m008564
Setaria italicaSi034324mSi035828mSi001622mSi001623mSi022172m
Si001579mSi022174mSi017280mSi009832mSi022143m
Selaginella moellendorffii4427235415442111
Sorghum bicolorSb01g045550.2Sb01g045550.1Sb01g050110.1Sb04g021180.1Sb03g044530.1
Sb09g027440.1Sb03g044510.1Sb03g044520.1Sb09g027450.1Sb06g014730.1
Sb09g022500.1
Thellungiella halophilaThhalv10005794mThhalv10013464mThhalv10016649mThhalv10007763mThhalv10004300m
Thhalv10016978mThhalv10017970m
Vitis viniferaGSVIVT01033325001GSVIVT01031485001GSVIVT01008661001GSVIVT01001097001
Volvox carteriVocar20000771mVocar20012246m.303.655Vocar20012246m.303.655Vocar20008669mVocar20007830m
Vocar20002407mVocar20006369mVocar20012208mVocar20003734mVocar20003733m
Vocar20009740mVocar20000485mVocar20000433mVocar20011523mVocar20005616m
Vocar20013770mVocar20002011mVocar20012823mVocar20005376mVocar20011529m
Vocar20011583mVocar20010952mVocar20005743mVocar20001869mVocar20005584m
Vocar20014463mVocar20009656mVocar20001757m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)