y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.001G015800.1
FamilyGT77
Protein PropertiesLength: 429 Molecular Weight: 48032.3 Isoelectric Point: 8.386
ChromosomeChromosome/Scaffold: 01 Start: 1330615 End: 1334472
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771834060
  IPNYLVVALDDNIEEFCKSNDVPVYRRDPDQGVDAVGKSGGNHAVSGLKFRILREFLQLGYSVLLSDVDIVYLQNPFDYLYRDSDVESMSDGHNNMTAYG
  YNDVFDEPSMGWARYAHTMRIWVYNSGFFYIRPTIPSIELLDRVANRLSNDAKAWDQAVFNEELFFPSHPGYDGLYAAKRTMDMYLFMNSKVLFKTVRKD
  AKLKKLKPVIIHVNYHPNKFERMK
Full Sequence
Protein Sequence     Length: 429     Download
MVGRRDALLT RDKGQSSVGS RIVAAVVVGV LIGCVVAFLA PNGLLTASPT PLIRHPKMVS    60
SACESPEQVN LLKVDILSAK EKNSELKKQV KDLMEKLRLA EQGKGHAQEQ FLVLGDSHKA    120
GPFGTVKALR TNPPVIPDES VNPRLAKILG EVAIYKEIIV ALANTNVKEM LQLWFTNIKK    180
VGIPNYLVVA LDDNIEEFCK SNDVPVYRRD PDQGVDAVGK SGGNHAVSGL KFRILREFLQ    240
LGYSVLLSDV DIVYLQNPFD YLYRDSDVES MSDGHNNMTA YGYNDVFDEP SMGWARYAHT    300
MRIWVYNSGF FYIRPTIPSI ELLDRVANRL SNDAKAWDQA VFNEELFFPS HPGYDGLYAA    360
KRTMDMYLFM NSKVLFKTVR KDAKLKKLKP VIIHVNYHPN KFERMKAIVE FYANGKQDAL    420
 DHFPDGSD*                                                           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans3.0e-56183405232+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU19369.1044285425unknown [Glycine max]
DDBJBAC83249.1014281426hypothetical protein [Oryza sativa Japonica Group]
GenBankEEC82354.1014281426hypothetical protein OsI_26669 [Oryza sativa Indica Group]
RefSeqNP_001140234.1014281423hypothetical protein LOC100272274 [Zea mays]
RefSeqXP_002465078.1034285425hypothetical protein SORBIDRAFT_01g031700 [Sorghum bicolor]
Transmembrane Domains
StartEnd
1739
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2681363061234280
GO8485353001304290
JG9484792791183960
GO883664314603730
GO883664343663990.031
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00429.1
Arabidopsis lyrata476651472163476650
Arabidopsis thalianaAT1G19360.1AT1G75120.1AT1G75110.1
Brachypodium distachyonBradi1g15990.1Bradi1g23050.1
Brassica rapaBra016507Bra025734
Carica papayaevm.model.supercontig_62.116evm.model.supercontig_64.63
Capsella rubellaCarubv10021612mCarubv10011112mCarubv10020421mCarubv10021694m
Chlamydomonas reinhardtiiCre12.g552400.t1.3Cre10.g418300.t1.2g11937.t1Cre06.g288500.t1.2Cre02.g111000.t1.2
Citrus clementinaCiclev10001254m
Citrus sinensisorange1.1g014357m
Cucumis sativusCucsa.342160.1Cucsa.240290.1
Eucalyptus grandisEucgr.I01250.1Eucgr.I01251.1Eucgr.I01249.1Eucgr.F01547.1
Fragaria vescamrna02178.1-v1.0-hybridmrna15113.1-v1.0-hybrid
Glycine maxGlyma11g12750.1Glyma14g08280.1Glyma12g04930.1Glyma17g36770.2
Gossypium raimondiiGorai.012G146400.1Gorai.012G146400.2Gorai.010G011500.1
Linum usitatissimumLus10026327Lus10032710Lus10042340Lus10018812
Malus domesticaMDP0000152163MDP0000259542MDP0000518381MDP0000208242MDP0000314698
MDP0000242848
Manihot esculentacassava4.1_007950mcassava4.1_008109m
Mimulus guttatusmgv1a006896mmgv1a006728mmgv1a006960m
Oryza sativaLOC_Os07g39840.1
Panicum virgatumPavirv00016039mPavirv00037224mPavirv00044239mPavirv00031762m
Physcomitrella patensPp1s246_43V6.1Pp1s351_31V6.1
Phaseolus vulgarisPhvul.011G047000.1
Picea abiesMA_54369g0010
Populus trichocarpaPotri.014G042700.1Potri.014G042700.2Potri.014G042700.3Potri.002G134400.1Potri.009G113300.1
Prunus persicappa006072mppa005997m
Ricinus communis30170.m01400629851.m002438
Setaria italicaSi029932mSi035830m
Selaginella moellendorffii103279431230
Sorghum bicolorSb02g037900.1Sb01g031700.1
Thellungiella halophilaThhalv10007712mThhalv10018600m
Vitis viniferaGSVIVT01009666001GSVIVT01031309001
Volvox carteriVocar20009953mVocar20009597mVocar20012076m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny