y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.001G063800.1
FamilyGT47
Protein PropertiesLength: 443 Molecular Weight: 50844.5 Isoelectric Point: 9.3893
ChromosomeChromosome/Scaffold: 01 Start: 7952925 End: 7961945
DescriptionExostosin family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47683650
  SLKIYVYEPEEINGLNDLLHGRDGKVTEEACLKGQWGTQVKIHKFLLQSKQRTRKKEEADLFFVPSYVKCARMMGGLNDKEINNTYVQVISQMPYFRLSG
  GRNHIFVFPSGAGAHLFKSWATYINRSIILTPEGDRTDKRDTSAFNTWKDIIIPGNVDDGMTKTGATVVQPLPLPKRKYLANYLGRAQGKAGRLKLIELA
  KQFPEKLECPDLKFSGPDKLARKEYFEHLRNSKFCLAPRGESSWTLRFYESFFVECVPVIISDQTELPFQNVIDYSQISIKWPSSRVGPELLQYLESI
Full Sequence
Protein Sequence     Length: 443     Download
MSASNKWRAM SPHHHQQQPL CTRTHQIGTL LLVTTTFFFT RLLSPCSLST GIVHVSHPQL    60
QWGQSQLSLK IYVYEPEEIN GLNDLLHGRD GKVTEEACLK GQWGTQVKIH KFLLQSKQRT    120
RKKEEADLFF VPSYVKCARM MGGLNDKEIN NTYVQVISQM PYFRLSGGRN HIFVFPSGAG    180
AHLFKSWATY INRSIILTPE GDRTDKRDTS AFNTWKDIII PGNVDDGMTK TGATVVQPLP    240
LPKRKYLANY LGRAQGKAGR LKLIELAKQF PEKLECPDLK FSGPDKLARK EYFEHLRNSK    300
FCLAPRGESS WTLRFYESFF VECVPVIISD QTELPFQNVI DYSQISIKWP SSRVGPELLQ    360
YLESIPDEEI ERIIALGRQV RCWWVYASDS EPCSAMRGIM WELQRKVRQF HHSAETFWLH    420
NGSIVNRNLV QFSKWELPVP LP*                                            480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin2.0e-4669365312+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_564141.1034425462exostosin family protein [Arabidopsis thaliana]
RefSeqXP_002265632.1024423459PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300942.10844210460predicted protein [Populus trichocarpa]
RefSeqXP_002307477.10844210460predicted protein [Populus trichocarpa]
RefSeqXP_002526175.102144221453catalytic, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO781282307203260
FE7079142791093870
FE7079132741704430
HO803338220252440
HO781282473193655e-18
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00344.3Aquca_014_00344.1Aquca_014_00344.2
Arabidopsis lyrata472383
Arabidopsis thalianaAT1G21480.2AT1G21480.1
Brachypodium distachyonBradi5g20997.1
Brassica rapaBra016420Bra017918
Carica papayaevm.model.supercontig_49.73
Capsella rubellaCarubv10009077m
Citrus clementinaCiclev10001673mCiclev10002072mCiclev10001104mCiclev10001922m
Cucumis sativusCucsa.077120.2Cucsa.077120.1
Eucalyptus grandisEucgr.E02380.2Eucgr.E02380.1
Fragaria vescamrna00939.1-v1.0-hybrid
Glycine maxGlyma14g38290.1
Gossypium raimondiiGorai.005G082700.1Gorai.005G082700.6Gorai.005G082700.3Gorai.005G082700.2Gorai.005G082700.4
Gorai.005G082700.5
Linum usitatissimumLus10028632Lus10018930
Malus domesticaMDP0000251576MDP0000259719
Manihot esculentacassava4.1_011268mcassava4.1_012629m
Mimulus guttatusmgv1a006022m
Panicum virgatumPavirv00023264mPavirv00031056m
Physcomitrella patensPp1s48_252V6.1
Populus trichocarpaPotri.002G072300.1Potri.005G187400.3Potri.005G187400.2Potri.005G187400.1
Prunus persicappa005428m
Ricinus communis27985.m000889
Setaria italicaSi002210mSi002276mSi001530m
Selaginella moellendorffii104774
Sorghum bicolorSb03g040220.1
Thellungiella halophilaThhalv10007584m
Vitis viniferaGSVIVT01010019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny