y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.001G115700.1
FamilyGH51
Protein PropertiesLength: 678 Molecular Weight: 74678 Isoelectric Point: 5.1934
ChromosomeChromosome/Scaffold: 01 Start: 32562240 End: 32570947
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH511986590
  NWTKKETLLVAKATDHNSRLQFTTTTKGVIWLDQVSAMPLDTYKGHGFRTELFEMLSDLKPKFIRFPGGCFVEGEWLRNAFRWKATVGPWEERPGHFGDV
  WMYWTDDGLGYFEFLQLAEDLGALPIWVFNNGVSHNDEVDTSVVLPLVQEALDGIEFARGDPTSKWGSLRAAMGHPEPFDLRYVAVGNEDCGKPKYQGNY
  LKFYHAIRSAYPDIQIISNCDGSSRPLDHPADMYDYHVYTNANDMFSRANAFDRTSRNGPKAFVSEYAVTGKDAGTGSLLAALAEAGFLIGLEKNSDVIE
  MVSYAPLFVNANDRRWNPDAIVFNSFQAYGTPSYWVQLFFSESSGATLLNTSLQSNSSNSVIASAITFQSSVDKKNYIRIKVVNFGTSAVNLKISLEGLE
  PDSLQLSGSTRTVLTSGNVMDENSFSQPRKVAPIQSRLQNVGKDLNVTIPPRSFTSFDLLKE
Full Sequence
Protein Sequence     Length: 678     Download
MGSFKAICSV SLLQLFIVFC LVFQCFATRR HTDPRTTLVV DASNAIGRPI PETLFGIFFE    60
EINHAGAGGL WAELVSNRGF EAGGPNTPSN IDPWTIIGNE SSIIVETDRT SCFDRNKVAL    120
RLEVLCDSEG DNICPAEGVG VYNPGFWGMN IEQGKKYKVI FYVRSTESLN LTVSLIGQSS    180
VGNLASSTIT GNAADFSNWT KKETLLVAKA TDHNSRLQFT TTTKGVIWLD QVSAMPLDTY    240
KGHGFRTELF EMLSDLKPKF IRFPGGCFVE GEWLRNAFRW KATVGPWEER PGHFGDVWMY    300
WTDDGLGYFE FLQLAEDLGA LPIWVFNNGV SHNDEVDTSV VLPLVQEALD GIEFARGDPT    360
SKWGSLRAAM GHPEPFDLRY VAVGNEDCGK PKYQGNYLKF YHAIRSAYPD IQIISNCDGS    420
SRPLDHPADM YDYHVYTNAN DMFSRANAFD RTSRNGPKAF VSEYAVTGKD AGTGSLLAAL    480
AEAGFLIGLE KNSDVIEMVS YAPLFVNAND RRWNPDAIVF NSFQAYGTPS YWVQLFFSES    540
SGATLLNTSL QSNSSNSVIA SAITFQSSVD KKNYIRIKVV NFGTSAVNLK ISLEGLEPDS    600
LQLSGSTRTV LTSGNVMDEN SFSQPRKVAP IQSRLQNVGK DLNVTIPPRS FTSFDLLKES    660
SNLRMNGSNS SCTRSSI*                                                  720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA0.00257165082+
COG3534AbfA4.0e-29244389146+
pfam06964Alpha-L-AF_C7.0e-38462650202+
smart00813Alpha-L-AF_C2.0e-45462650199+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP97437.102067018669alpha-L-arabinofuranosidase [Malus x domestica]
GenBankABV32544.102067518676alpha-L-arabinofuranosidase protein [Prunus persica]
DDBJBAF42035.1016771675alpha-Arabinosidase1 [Pyrus communis]
RefSeqXP_002307940.1016771670predicted protein [Populus trichocarpa]
RefSeqXP_002523672.102567729678Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4atw_F1e-1924465648481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_E1e-1924465648481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_D1e-1924465648481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_C1e-1924465648481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_B1e-1924465648481A Chain A, The Crystal Structure Of Arabinofuranosidase
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7807404072726780
HO8072913181514680
HO7959483323476780
HO8526834152446560
CB8935942841854680
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)