y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.001G116300.1
FamilyGH51
Protein PropertiesLength: 649 Molecular Weight: 71477.9 Isoelectric Point: 6.3043
ChromosomeChromosome/Scaffold: 01 Start: 32690700 End: 32695983
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH512136430
  TKKGVIWLDQVSAMPVDTYKGHGFRSDLVNMLIDLKPAFLRFPGGCFIEGQRLRNAFRWKNSVGPWEQRPGHFGDVWSYWTDDGFGYFEGLQLAEDIGAR
  PLWVFNSGISHTEEIDTKDITPFVQESLDGIEFARGAASSKWGSLRASMGHPDPFDLKYVAVGNEDCQKKNYQGNYLAFYKAIKAAYPDIQIVSNCDASS
  KPLNHPADIYDYHTYPKEYETMFNNADVFDKTPRNGPKAFVSEYALIGEQAKQGTLLGAVSEAGFLIGLERNSDHVIMASYAPLFVNANDRKWNPDAIVF
  SSNQVYGTPSYWVQFMFRESNGATLLKSQLQTPHPNSVAASAIICKNSQTYLKIKVANVGKSPINLKISLKGIESSEATKATKTVLTSADASDGNSFANP
  TKIVPKRNPHTSAGKEINDILPPVSFTVFDL
Full Sequence
Protein Sequence     Length: 649     Download
MIFTKACCSF LWTYLVIGAC FAFRCYADAN QTSTLVVDVS DSGRQIPDTL FGIFFEEINH    60
AGTGGLWEEL VNNRGFEAGG TRVPSSIAPW TVVGKEPAIF LETELSSCFE HNKVALKIDV    120
QCDKCPSDGV GVSNPGFWGM NIVEGKKYKV VFFVKSKGAL EMTVSFRETE GGRILASSNI    180
IASASEVSNW KRMETTLEAD ASSSDSSLYL TTTKKGVIWL DQVSAMPVDT YKGHGFRSDL    240
VNMLIDLKPA FLRFPGGCFI EGQRLRNAFR WKNSVGPWEQ RPGHFGDVWS YWTDDGFGYF    300
EGLQLAEDIG ARPLWVFNSG ISHTEEIDTK DITPFVQESL DGIEFARGAA SSKWGSLRAS    360
MGHPDPFDLK YVAVGNEDCQ KKNYQGNYLA FYKAIKAAYP DIQIVSNCDA SSKPLNHPAD    420
IYDYHTYPKE YETMFNNADV FDKTPRNGPK AFVSEYALIG EQAKQGTLLG AVSEAGFLIG    480
LERNSDHVIM ASYAPLFVNA NDRKWNPDAI VFSSNQVYGT PSYWVQFMFR ESNGATLLKS    540
QLQTPHPNSV AASAIICKNS QTYLKIKVAN VGKSPINLKI SLKGIESSEA TKATKTVLTS    600
ADASDGNSFA NPTKIVPKRN PHTSAGKEIN DILPPVSFTV FDLLIRRP*                660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA6.0e-36235643486+
pfam06964Alpha-L-AF_C8.0e-40463637184+
smart00813Alpha-L-AF_C8.0e-43463637183+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP97437.102064618657alpha-L-arabinofuranosidase [Malus x domestica]
GenBankABV32544.102064618660alpha-L-arabinofuranosidase protein [Prunus persica]
DDBJBAF42035.101564613657alpha-Arabinosidase1 [Pyrus communis]
RefSeqXP_002307940.1016481660predicted protein [Populus trichocarpa]
RefSeqXP_002523672.102864435659Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2c_L2e-1923564348481A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_K2e-1923564348481A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_J2e-1923564348481A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_I2e-1923564348481A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_H2e-1923564348481A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8526834152356430
HO7807403852656440
GT0462043512205670
DR8227752932145060
GE4801222972475430
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)