Basic Information | |
---|---|
Species | Phaseolus vulgaris |
Cazyme ID | Phvul.001G117500.1 |
Family | CBM20 |
Protein Properties | Length: 339 Molecular Weight: 38280.6 Isoelectric Point: 8.5449 |
Chromosome | Chromosome/Scaffold: 01 Start: 32920502 End: 32923326 |
Description | disproportionating enzyme 2 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM20 | 16 | 104 | 3.3e-22 |
VKVSFRIPYFTQWGQSLLVCGSVPVLGAWNVKRGVLLSVIHQGSELIWGGSTTVPRGFQCQYSYYVVDDKKNVLRWETGKKRELIIPEG |
Full Sequence |
---|
Protein Sequence Length: 339 Download |
MVNPGLFSGN KSVNSVKVSF RIPYFTQWGQ SLLVCGSVPV LGAWNVKRGV LLSVIHQGSE 60 LIWGGSTTVP RGFQCQYSYY VVDDKKNVLR WETGKKRELI IPEGVQSGQE IVFRDLWQAA 120 SDALPFRSAF KDVIFRESWD LSDTTAGVNH INFEPEREAV LVQFKISCPN VEKDSSIYVI 180 GSNTKLGQWK AEKGLKLSYF GESVWKAECV MQRSDFPLRY RYGKYDRNGK FSIETGSNRE 240 VSTNSSTNDV KYIFLSDGML RETPWRGAGV AIPMFSVRSE SDLGVGEFLD LKLLVDWAVA 300 SGFHLVQLLP INDTSVHGMW WDSYPYRYGS FKIIVEIR* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
cd02860 | E_set_Pullulanase | 1.0e-9 | 29 | 115 | 88 | + Early set domain associated with the catalytic domain of pullulanase (also called dextrinase and alpha-dextrin endo-1,6-alpha glucosidase). E or "early" set domains are associated with the catalytic domain of pullulanase at either the N-terminal or C-terminal end, and in a few instances at both ends. Pullulanase is an enzyme with activity similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. The E set domain of pullulanase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase. |
PLN03236 | PLN03236 | 2.0e-22 | 253 | 326 | 75 | + 4-alpha-glucanotransferase; Provisional |
cd02860 | E_set_Pullulanase | 1.0e-30 | 162 | 258 | 98 | + Early set domain associated with the catalytic domain of pullulanase (also called dextrinase and alpha-dextrin endo-1,6-alpha glucosidase). E or "early" set domains are associated with the catalytic domain of pullulanase at either the N-terminal or C-terminal end, and in a few instances at both ends. Pullulanase is an enzyme with activity similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. The E set domain of pullulanase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase. |
cd02859 | E_set_AMPKbeta_like_N | 1.0e-44 | 20 | 117 | 98 | + N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase. |
PLN02950 | PLN02950 | 1.0e-155 | 20 | 326 | 309 | + 4-alpha-glucanotransferase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003824 | catalytic activity |
GO:0004134 | 4-alpha-glucanotransferase activity |
GO:0005975 | carbohydrate metabolic process |
GO:2001070 | starch binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAR99599.1 | 0 | 1 | 326 | 1 | 318 | 4-alpha-glucanotransferase [Solanum tuberosum] |
GenBank | ACN50178.1 | 0 | 1 | 326 | 1 | 327 | disproportionating enzyme 2 [Annona cherimola] |
EMBL | CBI32836.1 | 0 | 1 | 326 | 1 | 327 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002278329.1 | 0 | 1 | 326 | 1 | 327 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002308854.1 | 0 | 1 | 326 | 1 | 341 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1kum_A | 0.000002 | 15 | 118 | 6 | 108 | A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3 |
PDB | 1kul_A | 0.000002 | 15 | 118 | 6 | 108 | A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3 |
PDB | 1acz_A | 0.000002 | 15 | 118 | 6 | 108 | A Chain A, Glucoamylase, Granular Starch-Binding Domain Complex With Cyclodextrin, Nmr, 5 Structures |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
JK614686 | 238 | 88 | 325 | 0 |
FG861536 | 225 | 1 | 225 | 0 |
HO794605 | 214 | 113 | 326 | 0 |
HO779714 | 204 | 123 | 326 | 0 |
HO779714 | 31 | 96 | 126 | 0.0006 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|