y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.001G117700.1
FamilyGH77
Protein PropertiesLength: 647 Molecular Weight: 75016 Isoelectric Point: 5.3803
ChromosomeChromosome/Scaffold: 01 Start: 32934205 End: 32940925
Descriptiondisproportionating enzyme 2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH7715930
  SLSVFALHPLYLRVQALSKNIPEEIKKDIDKAKQQLDGKDVDYEATMATKLSIAKKVFAEEKDLILNSSSFQEFFLENEGWLKPYAAFSFLRDFFETSDR
  SQWGRFAHYSDDKLEKLVSKDSLHYEIICFHYYVQYHLHLQLSEAAEYARKKGVILKGDLPIGVDRNSVDTWVYPNLFRMNTSTGAPPDYFDKNGQNWGF
  PTYNWEEMSKDNYGWWRARLTQMAKYFTAYRIDHILGFFRIWELPDHAATGLVGKFRPSIPLSQEELEREGIWDFNRLSRPYIKRELLEEKFGAAWTFVA
  TTFLNELDKNFYEFKEDSNTEKKIASKLKTCAGSSLLLESEDKLRRNLFDLSQNIVLIRDPEYPRKFYPRFNLEDTSSFQDLDDHSKNVLKRLYNDYYFC
  RQENLWSQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRMPNEPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEDRRLRFFK
  NVVESDELPPDQCVPEVAHFVLRQHFEAPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRYRVHVSLESLIKDIELQTTIKDLVR
Full Sequence
Protein Sequence     Length: 647     Download
SLSVFALHPL YLRVQALSKN IPEEIKKDID KAKQQLDGKD VDYEATMATK LSIAKKVFAE    60
EKDLILNSSS FQEFFLENEG WLKPYAAFSF LRDFFETSDR SQWGRFAHYS DDKLEKLVSK    120
DSLHYEIICF HYYVQYHLHL QLSEAAEYAR KKGVILKGDL PIGVDRNSVD TWVYPNLFRM    180
NTSTGAPPDY FDKNGQNWGF PTYNWEEMSK DNYGWWRARL TQMAKYFTAY RIDHILGFFR    240
IWELPDHAAT GLVGKFRPSI PLSQEELERE GIWDFNRLSR PYIKRELLEE KFGAAWTFVA    300
TTFLNELDKN FYEFKEDSNT EKKIASKLKT CAGSSLLLES EDKLRRNLFD LSQNIVLIRD    360
PEYPRKFYPR FNLEDTSSFQ DLDDHSKNVL KRLYNDYYFC RQENLWSQNA LKTLPVLLNS    420
SDMLACGEDL GLIPSCVHPV MQELGLVGLR IQRMPNEPDL EFGIPSQYSY MTVCAPSCHD    480
CSTLRAWWEE DEDRRLRFFK NVVESDELPP DQCVPEVAHF VLRQHFEAPS MWAIFPLQDL    540
LALKEEYTTR PATEETINDP TNPKHYWRYR VHVSLESLIK DIELQTTIKD LVRWSGRSVP    600
KEDSGVDASL VAALSVAEAV SVLSVAEAVS GKQKFSSTTE KPVLVK*                  660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02446Glyco_hydro_773.0e-46416593179+
PRK14508PRK145082.0e-581259269+
pfam02446Glyco_hydro_771.0e-951255256+
PLN02950PLN0295001588588+
PLN03236PLN0323601598624+
Gene Ontology
GO TermDescription
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAR99599.1016033209224-alpha-glucanotransferase [Solanum tuberosum]
RefSeqNP_181616.301607331937DPE2 (DISPROPORTIONATING ENZYME 2); 4-alpha-glucanotransferase/ heteroglycan binding [Arabidopsis thaliana]
RefSeqXP_002308854.101600343942predicted protein [Populus trichocarpa]
RefSeqXP_002323208.101600293892predicted protein [Populus trichocarpa]
RefSeqXP_002523669.1016462568884-alpha-glucanotransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2x1i_A6e-234125695316A Chain A, Glycoside Hydrolase Family 77 4-Alpha-Glucanotransferase From Thermus Brockianus
PDB1x1n_A3e-22135271217361A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB1x1n_A0.001426597366523A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB1fp9_A9e-22125661316A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794605573756470
HO77971430413040
HO7814342812605400
HO794605901902e-35
HO781434322062376e-19
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00493.1Aquca_014_00493.2Aquca_009_00054.2Aquca_009_00054.1Aquca_009_00054.3.267.859
Arabidopsis lyrata496706483146
Arabidopsis thalianaAT5G64860.1AT2G40840.1
Brachypodium distachyonBradi1g20790.1Bradi1g18650.1.259.907
Brassica rapaBra037799Bra004590
Carica papayaevm.model.supercontig_196.11evm.model.supercontig_92.60
Capsella rubellaCarubv10026154mCarubv10022587m
Chlamydomonas reinhardtiiCre03.g181500.t1.2g1899.t1
Citrus clementinaCiclev10025236mCiclev10025748mCiclev10025303m.221.544Ciclev10025303m.221.544Ciclev10025303m.94.221
Ciclev10025303m.94.221Ciclev10010989m.279.926
Citrus sinensisorange1.1g007886morange1.1g009906morange1.1g002052m.279.926orange1.1g002050m.279.926orange1.1g002027m.279.929
Cucumis sativusCucsa.250500.2Cucsa.250500.1Cucsa.250500.10
Eucalyptus grandisEucgr.I00325.1Eucgr.K01679.1.272.918
Fragaria vescamrna31442.1-v1.0-hybridmrna31443.1-v1.0-hybridmrna00258.1-v1.0-hybrid.543.676mrna00258.1-v1.0-hybrid.543.676
Glycine maxGlyma04g39730.1Glyma06g15140.1Glyma03g27600.1.272.920Glyma19g30580.1.272.920
Gossypium raimondiiGorai.003G047100.1Gorai.003G047100.2Gorai.003G047100.3Gorai.003G047100.4Gorai.010G128900.7.272.586
Gorai.010G128900.6.272.586Gorai.010G128900.3Gorai.010G128900.5Gorai.010G128900.4Gorai.010G128900.2
Gorai.010G128900.1
Linum usitatissimumLus10035845Lus10036626Lus10035408.186.791Lus10031010.709.828Lus10031010.709.828
Lus10031010.709.828Lus10031010.348.710Lus10031010.348.710Lus10031010.348.710Lus10031010.186.329
Lus10031010.186.329Lus10031010.186.329
Malus domesticaMDP0000243418.304.467MDP0000243418.304.467MDP0000243418.154.302MDP0000243418.154.302MDP0000149290.248.921
Manihot esculentacassava4.1_008552mcassava4.1_001086m.256.903
Medicago truncatulaMedtr3g094840.1Medtr7g088740.3Medtr7g088740.1.278.801Medtr7g088740.1.278.801Medtr7g088740.2.57.569
Medtr7g088740.2.57.569Medtr7g088740.2.581.734Medtr7g088740.2.581.734Medtr7g088740.1.813.966Medtr7g088740.1.813.966
Mimulus guttatusmgv1a004209m.70.300mgv1a004209m.70.300mgv1a004209m.302.523mgv1a004209m.302.523mgv1a000923m.250.897
Oryza sativaLOC_Os07g43390.1LOC_Os07g46790.1.269.917
Panicum virgatumPavirv00011352mPavirv00008161mPavirv00039603mPavirv00069371m.297.611Pavirv00070133m
Pavirv00069370m.297.826Pavirv00069369m.272.920
Physcomitrella patensPp1s44_268V6.1Pp1s117_77V6.1Pp1s8_30V6.1Pp1s253_27V6.1
Phaseolus vulgarisPhvul.009G139500.1
Picea abiesMA_10429341g0010MA_225933g0010MA_1108864g0010MA_10433631g0010MA_10432229g0010
Populus trichocarpaPotri.007G081400.1Potri.006G031700.4Potri.016G028900.3Potri.016G028900.2Potri.016G028900.1
Potri.006G031700.3Potri.006G031700.2Potri.006G031700.1
Prunus persicappa003327mppa011408mppa000782m.305.951
Ricinus communis29719.m00033330045.m000475.200.845
Setaria italicaSi029329mSi034110m.272.920Si028900m.276.863Si028839m.276.923
Selaginella moellendorffii109836444105427302268243
Sorghum bicolorSb02g040000.1Sb02g042100.1.268.916
Thellungiella halophilaThhalv10003902mThhalv10016195m
Vitis viniferaGSVIVT01022223001GSVIVT01025810001.273.921
Volvox carteriVocar20008073mVocar20014639m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)