y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.001G122100.1
FamilyAA1
Protein PropertiesLength: 220 Molecular Weight: 23715.2 Isoelectric Point: 7.9733
ChromosomeChromosome/Scaffold: 01 Start: 34436830 End: 34437838
DescriptionLaccase/Diphenol oxidase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA172140
  GEWWKSDTEVVINEALKSGLAPNVSDAHTINGHPGPVQGCASQEGFKLDVQPGNIYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPFKTDTIVITP
  GQTTNVLLTTKHAAGKYLVAASPFMDAPIAVDNKTATAILHYSGTLSSSLTTLTSMPPKNSTILATSFTDSLRSLNSKKYPARVPLKIDRNLLFTVSLGI
  NPCATCLN
Full Sequence
Protein Sequence     Length: 220     Download
MTRTQCGEWW KSDTEVVINE ALKSGLAPNV SDAHTINGHP GPVQGCASQE GFKLDVQPGN    60
IYLLRIINAA LNEELFFKIA GHELTVVEVD AVYTKPFKTD TIVITPGQTT NVLLTTKHAA    120
GKYLVAASPF MDAPIAVDNK TATAILHYSG TLSSSLTTLT SMPPKNSTIL ATSFTDSLRS    180
LNSKKYPARV PLKIDRNLLF TVSLGINPCA TCLNNTLVQI                          240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03390ascorbOXfungal2.0e-113311792+
PLN02835PLN028351.0e-117149143+
PLN00044PLN000449.0e-127149153+
pfam00394Cu-oxidase7.0e-467150148+
TIGR03389laccase2.0e-1077212208+
Gene Ontology
GO TermDescription
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC49536.108212164368diphenol oxidase [Nicotiana tabacum]
RefSeqXP_002299828.107218162373predicted protein [Populus trichocarpa]
RefSeqXP_002314124.107218164375predicted protein [Populus trichocarpa]
RefSeqXP_002322961.108212164368laccase 1a [Populus trichocarpa]
RefSeqXP_002520425.108218165375laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3v9c_A0.0000000000828170163305A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3fpx_A0.0000000000828170163305A Chain A, Native Fungus Laccase From Trametes Hirsuta
PDB3pxl_A0.0000000000828170163305A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
PDB1v10_A0.00000000154158214317A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals
PDB2h5u_A0.00000000221170155305A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG49078320672120
EL35918920672120
FC89574920582120
DY30092220672120
DY29471220582120
Orthologous Group
SpeciesID
Glycine maxGlyma06g43701.1
Linum usitatissimumLus10040226
Medicago truncatulaMedtr5g081790.1
Phaseolus vulgarisPhvul.007G093200.1Phvul.009G027800.1
Picea abiesMA_6005856g0010MA_7461249g0010MA_10435604g0010MA_1991g0010MA_9916300g0010
Vitis viniferaGSVIVT01033192001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny