y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.001G199000.1
FamilyAA7
Protein PropertiesLength: 557 Molecular Weight: 61324.5 Isoelectric Point: 6.6887
ChromosomeChromosome/Scaffold: 01 Start: 46490909 End: 46501379
DescriptionFAD-linked oxidases family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA71333292.5e-26
  NIPDVIVYPRSEEEVSKIVSLCNMHKVPIVPYGGATSIEGHTLSPHGGVCIDMSLMKTVKALHVDDMDVVVEPGIGWMELNEYLEPYGLFFPLDPGPGAS
  IGGMCATRCSGSLAVRYGTMRDNVISLKVVLANGDIVKTASRARKSAAGYDLTRLMIGSEGTLGLITEVTLRLQKIPQHSVVAMCNFPSVKDAADVA
Full Sequence
Protein Sequence     Length: 557     Download
MSNFSSWLFR LRSSSSKFFY RYRTLHNKYA PTVFNNHSTR NASLTSLLPL ALALSAGSLA    60
LHPHFSPSFC DTERGVNIGG KGSTQFVVKG SHKEFPQELL EELKIICQDN ISVDYDERYI    120
HGKPQNSFHK AVNIPDVIVY PRSEEEVSKI VSLCNMHKVP IVPYGGATSI EGHTLSPHGG    180
VCIDMSLMKT VKALHVDDMD VVVEPGIGWM ELNEYLEPYG LFFPLDPGPG ASIGGMCATR    240
CSGSLAVRYG TMRDNVISLK VVLANGDIVK TASRARKSAA GYDLTRLMIG SEGTLGLITE    300
VTLRLQKIPQ HSVVAMCNFP SVKDAADVAI ATMRSGVQVS RVELLDEVQV KAINIANGKN    360
LPECPTLMFE FIGTEAYARE QTQIVRKLVS EHNGSDFVFA EEPEAKKELW KVRKEALWAC    420
FAMEPNLEAM ISDVCVPLSH LGDLISRSKK ELDASPLVCT VIAHAGDGNF HTVILFDPSQ    480
EEQRREAERL NQFMVYAALS FEGTCTGEHG VGTGKMKYLE EELGVEALRT MKKIKSVLDP    540
NNIMNPGKLI PPHICF*                                                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK11230PRK112303.0e-48134555430+
pfam02913FAD-oxidase_C4.0e-70308549247+
TIGR00387glcD6.0e-91138548419+
COG0277GlcD2.0e-122104552462+
PLN02805PLN02805066556492+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001142976.107055669555hypothetical protein LOC100275430 [Zea mays]
RefSeqNP_568170.104555651567FAD linked oxidase family protein [Arabidopsis thaliana]
RefSeqXP_002267321.1045563566PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002322755.10785561480predicted protein [Populus trichocarpa]
RefSeqXP_002524111.1045563555d-lactate dehydrogenase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3pm9_F1.00053e-4213755054476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_E1.00053e-4213755054476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_D1.00053e-4213755054476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_C1.00053e-4213755054476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_B1.00053e-4213755054476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2650383231494700
HO7837931911713610
HO783793103621640
HO7837931303584870
HO783793261581830.009
Orthologous Group
SpeciesID
Arabidopsis lyrata487468
Brassica rapaBra009208
Carica papayaevm.model.supercontig_222.7
Capsella rubellaCarubv10000524m
Citrus clementinaCiclev10011373m
Citrus sinensisorange1.1g011962morange1.1g015664morange1.1g015624morange1.1g008252m
Cucumis sativusCucsa.242270.1
Eucalyptus grandisEucgr.A02536.1
Fragaria vescamrna18037.1-v1.0-hybrid
Glycine maxGlyma03g36390.2Glyma03g36390.1
Gossypium raimondiiGorai.006G146800.1
Malus domesticaMDP0000293317MDP0000201766
Manihot esculentacassava4.1_004573m
Mimulus guttatusmgv1a003632m
Physcomitrella patensPp1s18_85V6.1
Picea abiesMA_9447266g0050
Populus trichocarpaPotri.016G064800.13Potri.016G064800.1Potri.016G064800.10Potri.016G064800.11Potri.016G064800.2
Potri.016G064800.3Potri.016G064800.4Potri.016G064800.5Potri.016G064800.6Potri.016G064800.7
Potri.016G064800.8Potri.016G064800.9Potri.016G064800.12
Prunus persicappa003803m
Ricinus communis29333.m001099
Thellungiella halophilaThhalv10013121m
Vitis viniferaGSVIVT01022507001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny