y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.001G254400.1
FamilyGH5
Protein PropertiesLength: 534 Molecular Weight: 59670.1 Isoelectric Point: 5.7016
ChromosomeChromosome/Scaffold: 01 Start: 51151035 End: 51156201
Description
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52084944.49817e-43
  GHGHNRAKDVLRRHRNSFITIEDFKFLYKHGINTVRIPVGWWIAFDPDPPGPYIGGSLEALDNAFLWAQEYDIKCIIDLHAAPGSQNGMEHSSSRDGFTG
  WPTSPDYISESLHVIDFLVSRYAKHPSLLGIELLNEPSAGTVSLDVLIPYYKQGYQIVRKYSSSAYVIICQRIGVADPLELYQANIGSHNIVLDLHFYNL
  FDPFFVNMSAVDNIQYIYKSREGQLQALNNSDGPLVLVGEWVNEWNVTNGSQKDYQDFGRAQLDVYNAASFGWCYWTVKNDREHWDF
Full Sequence
Protein Sequence     Length: 534     Download
MGLVFTKWAC AFLLCCCFIT SGVYSVEVLH GGSKVRGVNL GGWLVIEGWI KPSLFDGIAN    60
GDMLDGTEVQ FKSVTTQKYV SAENGGGMNV TVDRDVPSSW ETFRLWRVSE SEFQFRTSVG    120
QFLTCDGGGH SVSATAKSPS TSETYEIERS AKNRIHLKIK GGAYLQATTD GQLSANYPGT    180
PGWDDNAATF EMTIVSNSLH GDYQLANGHG HNRAKDVLRR HRNSFITIED FKFLYKHGIN    240
TVRIPVGWWI AFDPDPPGPY IGGSLEALDN AFLWAQEYDI KCIIDLHAAP GSQNGMEHSS    300
SRDGFTGWPT SPDYISESLH VIDFLVSRYA KHPSLLGIEL LNEPSAGTVS LDVLIPYYKQ    360
GYQIVRKYSS SAYVIICQRI GVADPLELYQ ANIGSHNIVL DLHFYNLFDP FFVNMSAVDN    420
IQYIYKSREG QLQALNNSDG PLVLVGEWVN EWNVTNGSQK DYQDFGRAQL DVYNAASFGW    480
CYWTVKNDRE HWDFEWNIRN SYLQLGNSSS KRSLNILGLL GLAFTWFCLL QFL*          540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam06268Fascin0.0058617691+
cd00257Fascin7.0e-5115211103+
cd00257Fascin9.0e-1369176108+
pfam00150Cellulase4.0e-19223488275+
COG2730BglC9.0e-23196504344+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0030674protein binding, bridging
GO:0051015actin filament binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI33153.10152360582unnamed protein product [Vitis vinifera]
RefSeqXP_002262875.10152948574PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310872.10355101478predicted protein [Populus trichocarpa]
RefSeqXP_002438060.1025238529hypothetical protein SORBIDRAFT_10g007500 [Sorghum bicolor]
RefSeqXP_002533566.10265338515conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A2e-2720240845252A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1eqp_A0.0043569943A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB3n9k_A4e-2720240850257A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB3n9k_A0.0042269148A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB1eqc_A4e-2720240845252A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0872742821434240
JG8545172502144630
EV26440721812180
CO1143502381603970
EY770527249893370
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)