y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G010600.1
FamilyGH43
Protein PropertiesLength: 469 Molecular Weight: 53568.6 Isoelectric Point: 7.5273
ChromosomeChromosome/Scaffold: 02 Start: 1212161 End: 1216303
Descriptionglycosyl hydrolase family protein 43
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH431553829e-34
  ILYDKKSRTYYWYGEYKDGPTYQIHKKGAARVDIIGVGCYSSKDLWTWKHEGIVLAAEETNETHDLHTSNVLERPKVIYNERTGKYVMWMHIDDANYTKA
  AAGVAISDTPDGPFDYLGSQRPHGYESRDMTVFKDDDGMAYLIYSSEDNSELHIGPLTEDYLNVTSVMRRILVGQHREAPALFKHQGTYYMITSGCTGWA
  PNEALAHAAESILGPWETIGNPCIGGNK
Full Sequence
Protein Sequence     Length: 469     Download
MRMRNKYRKP TTLGCNAGSR YSTSVVALSL LGCLFLLHLY TYVHHTDRTG GDSPLRLNHH    60
PQFIELQEVE EENIQIPPPK GKRSPRAAKR RPKRTTTLID EFLDENSQLR QVFFPGHKKT    120
IDPIQTPANE SYYYYPGRIW LDTDGNPIQA HGGGILYDKK SRTYYWYGEY KDGPTYQIHK    180
KGAARVDIIG VGCYSSKDLW TWKHEGIVLA AEETNETHDL HTSNVLERPK VIYNERTGKY    240
VMWMHIDDAN YTKAAAGVAI SDTPDGPFDY LGSQRPHGYE SRDMTVFKDD DGMAYLIYSS    300
EDNSELHIGP LTEDYLNVTS VMRRILVGQH REAPALFKHQ GTYYMITSGC TGWAPNEALA    360
HAAESILGPW ETIGNPCIGG NKMFRLTTFF AQSTFVLPLP GFPGSFIFMA DRWNPADLRD    420
SRYVWLPMIV AGSVDQPLDY SFEFPLWSRV SIYWHRKWTL PHGWSSFK*                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd08999GH43_ABN_22.0e-17163376232+
cd08990GH43_AXH_like4.0e-21193371193+
cd09004GH43_bXyl8.0e-22192375197+
cd08978GH_F2.0e-48151428289+
cd08985GH43_62.0e-132148428282+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU19498.101846815465unknown [Glycine max]
EMBLCBI33680.1014681434unnamed protein product [Vitis vinifera]
RefSeqNP_190557.1034614458glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqNP_201555.206046165466glycosyl hydrolase family protein 43 [Arabidopsis thaliana]
RefSeqXP_002525277.10146832499beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vt2_F014245250346A Chain A, Crystal Structure Of The Asn152gly Mutant Of P99 Beta-lactamase
PDB3vt2_E014245250346A Chain A, Crystal Structure Of The Asn152gly Mutant Of P99 Beta-lactamase
PDB3vt2_D014245250346A Chain A, Crystal Structure Of The Asn152gly Mutant Of P99 Beta-lactamase
PDB3vt2_C014245250346A Chain A, Crystal Structure Of The Asn152gly Mutant Of P99 Beta-lactamase
PDB3vt2_B014245250346A Chain A, Crystal Structure Of The Asn152gly Mutant Of P99 Beta-lactamase
Transmembrane Domains
StartEnd
2143
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8561533341314640
GO3743623451294690
GO8017532981684650
EY7037302951454390
GT7395993011324320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_060_00007.3Aquca_060_00007.1Aquca_060_00007.2
Arabidopsis lyrata906305332819
Arabidopsis thalianaAT5G67540.2AT5G67540.1AT3G49880.1
Brachypodium distachyonBradi2g50980.2Bradi1g71160.1Bradi2g50980.1
Brassica rapaBra024441Bra029980Bra036036
Capsella rubellaCarubv10027885mCarubv10019437m
Citrus clementinaCiclev10025553mCiclev10025552mCiclev10025561m
Citrus sinensisorange1.1g011114morange1.1g012300morange1.1g012453m
Cucumis sativusCucsa.366970.1Cucsa.366990.1
Eucalyptus grandisEucgr.I00703.2Eucgr.I00703.1Eucgr.H02307.1
Fragaria vescamrna05759.1-v1.0-hybrid
Glycine maxGlyma05g22470.3Glyma17g17390.3Glyma17g17390.2Glyma17g17390.1Glyma05g22470.6
Glyma05g22470.5Glyma05g22470.4Glyma05g22470.2Glyma01g40190.1Glyma11g05100.1
Gossypium raimondiiGorai.011G214500.1Gorai.008G083400.1Gorai.003G030500.1Gorai.003G030500.2
Linum usitatissimumLus10011543Lus10019280
Malus domesticaMDP0000248963MDP0000503275MDP0000406084
Manihot esculentacassava4.1_032973mcassava4.1_007150mcassava4.1_007066m
Medicago truncatulaMedtr5g015460.1Medtr4g097110.1
Mimulus guttatusmgv1a018781mmgv1a005746m
Oryza sativaLOC_Os12g21789.1LOC_Os12g21789.2LOC_Os01g65720.1
Panicum virgatumPavirv00010178mPavirv00067870mPavirv00058950mPavirv00044467m
Physcomitrella patensPp1s410_9V6.1Pp1s16_243V6.1
Phaseolus vulgarisPhvul.003G234900.1
Picea abiesMA_181765g0010
Populus trichocarpaPotri.005G148800.1Potri.005G148800.2
Prunus persicappa005306m
Ricinus communis48021.m00001434138.m00001529661.m000924
Setaria italicaSi001388mSi035531m
Selaginella moellendorffii44066110234
Sorghum bicolorSb03g041630.1Sb01g043810.1
Thellungiella halophilaThhalv10004148mThhalv10010347m
Vitis viniferaGSVIVT01000105001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny