y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G025800.1
FamilyPL1
Protein PropertiesLength: 393 Molecular Weight: 44247.9 Isoelectric Point: 9.8896
ChromosomeChromosome/Scaffold: 02 Start: 2768161 End: 2769664
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11103100
  VWITFQRDMHIKLERPLLISSFTTIDGRGVNVDIAKNACLMVFKATNIIIHGIRIHDCKPQTPGVTMGPEGKVISLGHVDGDAIRLVTASKIWIDHNTLY
  NCQDGLLDVTRGSTDVTISNNWFRNQDKVMLLGHDDGYVRDQNMKVTVVYNHFGPNCNQRMPRIRHGYAHVVNNLYLGWLQYAIGGSMRPSLKSEANLFI
  A
Full Sequence
Protein Sequence     Length: 393     Download
MISGNITFSY WHFALNIIII GILFSNFSVA KQSKIHELKM NVIDQCWRLN PKWRIQRPQL    60
ATCSIGYAGK MINNIGEDLV HYKVIDPSDD PINPKPGTLR YGASVIQGKV WITFQRDMHI    120
KLERPLLISS FTTIDGRGVN VDIAKNACLM VFKATNIIIH GIRIHDCKPQ TPGVTMGPEG    180
KVISLGHVDG DAIRLVTASK IWIDHNTLYN CQDGLLDVTR GSTDVTISNN WFRNQDKVML    240
LGHDDGYVRD QNMKVTVVYN HFGPNCNQRM PRIRHGYAHV VNNLYLGWLQ YAIGGSMRPS    300
LKSEANLFIA PTRGNKEVTW RKNNNTNGDA WEFHSVKDAF ENGASFTVTK GGRVPKPNYN    360
EEQRFKVVDV KYVRSLTRSS GILRCTKTSL CG*                                 420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB4.0e-26128326219+
pfam00544Pec_lyase_C1.0e-50130308187+
smart00656Amb_all5.0e-64117311206+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26401.10713911320unnamed protein product [Vitis vinifera]
RefSeqXP_002267384.104039119369PREDICTED: similar to putative Cup s 1 pollen allergen [Vitis vinifera]
RefSeqXP_002299118.10403911354predicted protein [Populus trichocarpa]
RefSeqXP_002304865.10403911352predicted protein [Populus trichocarpa]
RefSeqXP_002527354.1063181307Major pollen allergen Jun v 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0413832345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0413832345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A8e-1710429942227A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A0.000000000000003126308128330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB1pcl_A0.00000000000000610830861276A Chain A, Unusual Structural Features In The Parallel Beta-Helix In Pectate Lyases
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5757502251623860
DR808308255412880
FD7579992161243390
HO778688355413910
EL457563284413210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00024.1Aquca_018_00074.1Aquca_015_00229.1
Arabidopsis lyrata487738881338
Arabidopsis thalianaAT5G09280.1AT1G30350.1
Brassica rapaBra009375Bra012756
Carica papayaevm.model.supercontig_42.185evm.model.supercontig_51.17
Capsella rubellaCarubv10002943mCarubv10006459m
Citrus sinensisorange1.1g041616m
Cucumis sativusCucsa.112490.1
Eucalyptus grandisEucgr.K02336.1
Fragaria vescamrna29291.1-v1.0-hybrid
Glycine maxGlyma11g06761.1Glyma01g38540.1Glyma16g25710.2Glyma13g21880.2
Gossypium raimondiiGorai.010G196700.1Gorai.010G196900.1Gorai.010G197000.1Gorai.010G197100.1Gorai.010G197400.1
Gorai.008G271800.1Gorai.008G271900.1Gorai.010G197600.1Gorai.010G197500.1Gorai.004G231500.1
Gorai.010G196800.1Gorai.010G197300.1
Linum usitatissimumLus10031867Lus10031296
Malus domesticaMDP0000244018MDP0000233331MDP0000166129
Manihot esculentacassava4.1_026008mcassava4.1_024289mcassava4.1_025601mcassava4.1_023158m
Medicago truncatulaMedtr6g077900.1Medtr8g078350.1Medtr5g035840.1Medtr5g019060.1Medtr4g064420.1
Medtr3g030900.1Medtr8g078310.1Medtr8g078390.1Medtr8g078280.1Medtr5g019090.1
Medtr5g019170.1Medtr5g019160.1
Mimulus guttatusmgv1a021987m
Oryza sativaLOC_Os08g18970.1
Panicum virgatumPavirv00017566m
Physcomitrella patensPp1s385_14V6.1Pp1s45_65V6.1
Phaseolus vulgarisPhvul.004G101900.1Phvul.004G098100.1Phvul.004G101600.1
Picea abiesMA_10433764g0010
Populus trichocarpaPotri.003G218200.1Potri.001G007400.1Potri.003G218200.2Potri.005G064500.2Potri.005G064500.1
Prunus persicappa016145mppa021860mppa016917mppa025917mppa016255m
Ricinus communis29596.m00070329743.m000300
Setaria italicaSi013945m
Selaginella moellendorffii88799
Sorghum bicolorSb03g036930.1
Thellungiella halophilaThhalv10015832m
Vitis viniferaGSVIVT01024239001
Zea maysAC233851.1_FGT011
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny