y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G053000.1
FamilyGH95
Protein PropertiesLength: 826 Molecular Weight: 91896.7 Isoelectric Point: 6.065
ChromosomeChromosome/Scaffold: 02 Start: 4842975 End: 4848948
Description1,2-alpha-L-fucosidases
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9557850
  DLKIRFGEEGGKHWTDALPIGNGRLGAMICGHLHSETIHLNEDTLWTGTPADYTNSKAPQALSRVRNLVNRQQYPQATAAASALTGSNPSEAYQLLGDIK
  LDFDYSHLTGGQQSYQRELDLDTATVKVNYSVGDVQFKREHFASYPDQVIVTNISATQNARLSFTLSLQSKMINQTYLNGTNQIIMKGSCPGKRVSPQLQ
  HSPQDTPQGIQFSAILDLKIGGKNGVVTVLDDNKLKVEASDWAVLLLVASSSFSDPFTPPSDSKKDPTSACFSTLSSISNVSYSDLYAHHLKDYQDLFHR
  VSLKLMRSTQLNISEDSSLELKKLVPTVANLSLVDSVTQVSTSDRVKSFQTDEDPSLVELLFQYGRYLLISSSRPGTQVANLQGIWNKDLEPTWDGAPHL
  NINLEMNYWPALPCNLSECQEPLFDYLSSLSVNGSKTAYVNYQASGWVAHSKSDIWARTSAGHGDVLWALWPMGGAWLCTHLWEHYAYTMDKDFLEYKAY
  PIMEGCVSFLLSWLIEGNEGYLETNPSTSPEHNFIAPNGEPACVSQSSTMDVAIIHEVFSKFLSAAEVIGRTKDNIVRKVSEAQPRLRPLYIAQDGSIME
  WVKDFKDPEVHHRHLSHLFGLFPGHTITLEQTPALFEAAEKSLYKRGEEGPGWSTTWKTACWARLQNSSNAYKMIKRLINLVDPDHEIPFQGGLYSNLFA
  AHPPFQIDANFGFAAAVAEMFVQSTLSDLFLLPALPWEKWPNGSLKGLKARGGTTVNICWREGDLQEFGIWSEEQTRTTLT
Full Sequence
Protein Sequence     Length: 826     Download
MEASDLKIRF GEEGGKHWTD ALPIGNGRLG AMICGHLHSE TIHLNEDTLW TGTPADYTNS    60
KAPQALSRVR NLVNRQQYPQ ATAAASALTG SNPSEAYQLL GDIKLDFDYS HLTGGQQSYQ    120
RELDLDTATV KVNYSVGDVQ FKREHFASYP DQVIVTNISA TQNARLSFTL SLQSKMINQT    180
YLNGTNQIIM KGSCPGKRVS PQLQHSPQDT PQGIQFSAIL DLKIGGKNGV VTVLDDNKLK    240
VEASDWAVLL LVASSSFSDP FTPPSDSKKD PTSACFSTLS SISNVSYSDL YAHHLKDYQD    300
LFHRVSLKLM RSTQLNISED SSLELKKLVP TVANLSLVDS VTQVSTSDRV KSFQTDEDPS    360
LVELLFQYGR YLLISSSRPG TQVANLQGIW NKDLEPTWDG APHLNINLEM NYWPALPCNL    420
SECQEPLFDY LSSLSVNGSK TAYVNYQASG WVAHSKSDIW ARTSAGHGDV LWALWPMGGA    480
WLCTHLWEHY AYTMDKDFLE YKAYPIMEGC VSFLLSWLIE GNEGYLETNP STSPEHNFIA    540
PNGEPACVSQ SSTMDVAIIH EVFSKFLSAA EVIGRTKDNI VRKVSEAQPR LRPLYIAQDG    600
SIMEWVKDFK DPEVHHRHLS HLFGLFPGHT ITLEQTPALF EAAEKSLYKR GEEGPGWSTT    660
WKTACWARLQ NSSNAYKMIK RLINLVDPDH EIPFQGGLYS NLFAAHPPFQ IDANFGFAAA    720
VAEMFVQSTL SDLFLLPALP WEKWPNGSLK GLKARGGTTV NICWREGDLQ EFGIWSEEQT    780
RTTLTKRIHY KGTMVTTDLI TGIFYKFNGQ LKCLNSCSLS EMACS*                   840
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002270199.10681935840PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313154.10681913797predicted protein [Populus trichocarpa]
RefSeqXP_002313157.101582039836predicted protein [Populus trichocarpa]
RefSeqXP_002527475.10677925794conserved hypothetical protein [Ricinus communis]
RefSeqXP_002527476.10282333847conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rdy_B068003772A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2rdy_A068003772A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_B02277152836A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_A02277152836A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eab_B02277152836A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum (Apo Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG8986732433005420
ES8111423184787880
FG8398122395257630
EX2638603003876860
GO8766213494768240
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00007.1Aquca_083_00007.2Aquca_083_00007.3Aquca_083_00007.4Aquca_083_00007.5
Aquca_083_00007.6
Arabidopsis lyrata912968
Arabidopsis thalianaAT4G34260.1
Brachypodium distachyonBradi1g28366.1Bradi3g25226.2Bradi3g25226.1
Brassica rapaBra011514
Carica papayaevm.model.supercontig_106.113
Capsella rubellaCarubv10004274m
Citrus clementinaCiclev10027816mCiclev10027838mCiclev10027896mCiclev10027914m
Citrus sinensisorange1.1g003571morange1.1g003209morange1.1g004833morange1.1g004823morange1.1g007147m
orange1.1g007141morange1.1g007204morange1.1g010926morange1.1g012384m
Cucumis sativusCucsa.108860.1
Eucalyptus grandisEucgr.I01092.1Eucgr.I01093.1Eucgr.I01092.2Eucgr.I01091.1Eucgr.I01092.3
Fragaria vescamrna22851.1-v1.0-hybrid.28.414mrna22851.1-v1.0-hybrid.28.414mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.490.804
mrna22843.1-v1.0-hybrid.490.804mrna22851.1-v1.0-hybrid.412.731mrna22851.1-v1.0-hybrid.412.731
Glycine maxGlyma20g26646.1Glyma10g40690.1Glyma20g26653.1Glyma01g45470.1Glyma10g40690.2
Glyma10g40690.3Glyma10g40690.4Glyma01g45470.2
Gossypium raimondiiGorai.008G022000.1Gorai.008G022200.1Gorai.008G022200.3Gorai.008G022200.2Gorai.008G022000.2
Gorai.008G022000.3
Linum usitatissimumLus10020979Lus10026594Lus10029689Lus10013884Lus10026595.318.693
Lus10026595.318.693Lus10026595.49.314Lus10026595.49.314
Malus domesticaMDP0000212784MDP0000623980MDP0000623979
Manihot esculentacassava4.1_001723mcassava4.1_005093mcassava4.1_008652mcassava4.1_021629m
Medicago truncatulaMedtr4g127370.1
Mimulus guttatusmgv1a001249m
Oryza sativaLOC_Os10g19334.1LOC_Os10g19880.1LOC_Os10g19334.2
Panicum virgatumPavirv00068345mPavirv00058326mPavirv00053527mPavirv00056040mPavirv00052622m
Pavirv00070327mPavirv00065921m
Physcomitrella patensPp1s174_46V6.2.375.814Pp1s174_46V6.2.375.814Pp1s174_46V6.1.375.814Pp1s174_46V6.1.375.814Pp1s11165_1V6.1
Phaseolus vulgarisPhvul.007G041400.1
Picea abiesMA_6830674g0010MA_10427365g0010
Populus trichocarpaPotri.009G093900.1Potri.001G299000.6Potri.001G299000.1Potri.009G093500.1Potri.001G298900.1
Potri.001G299000.4Potri.009G093500.3Potri.001G298900.2Potri.001G299000.9Potri.001G299000.7
Potri.009G093500.2Potri.001G299000.5Potri.001G299000.2Potri.001G299000.3Potri.001G299000.11
Potri.009G093500.4Potri.001G299000.10Potri.001G299000.8Potri.001G299000.12
Prunus persicappa001398m
Ricinus communis28152.m00088228152.m000881
Setaria italicaSi040042mSi035391mSi040167mSi037248mSi037505m
Selaginella moellendorffii171005
Sorghum bicolorSb02g007180.1
Thellungiella halophilaThhalv10024398m
Vitis viniferaGSVIVT01037900001.265.748GSVIVT01037900001.265.748GSVIVT01037900001.32.242GSVIVT01037900001.32.242
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)