y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G078300.1
FamilyGT92
Protein PropertiesLength: 599 Molecular Weight: 68545.2 Isoelectric Point: 9.564
ChromosomeChromosome/Scaffold: 02 Start: 11676858 End: 11678654
DescriptionDomain of unknown function (DUF23)
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT923215441.8e-21
  NQASALREWVMYHAWLGVERWFIYDNNSDDDIEKVVQELDLQGFNVSRKSWPWIKTQEAGFSHCALRAREECKWVGFFDVDEFFYFPSEFRLNLREGVPG
  ENSLRSVVANFSSSKSIAEIRTACHSFGPSGLHSPPKQGVTLGYTCRLQSPERHKSIVRPDLLDISLLNVVHHFQLRQGFRYHNMPEGTAIVNHYKYQVW
  ETFKAKFFRRVATYVVDWQEDQNK
Full Sequence
Protein Sequence     Length: 599     Download
MEPEQRRKRK RAVGRHLHIS SRSLFLCFSF LIFLLFLSSH HRIFFFTPST FRPSLTASTL    60
SLLYSSSSNS ILDPLHPTAP SYTLQHRIIF PDHHLLILTT PQHQQHQLEC VYYTLHPNAN    120
ASSPAPPLQL QVRPVLSTDC YDESRSIVRC PFPQTNYTAA GSQTVELRRR GEVGRRNLGF    180
LLNQTVQSWD RVAYEAILDG DTVVVFVKGL NLRPHKISDP TRIRCHFGLK GFHQDNAFLL    240
TTRAISVAQE VVRCMLPQSI KNNPDKARGI RVTVSYLGGN VRHPVRALVP SVARVSTPGS    300
SIVQKRKRGK YELCACTMVW NQASALREWV MYHAWLGVER WFIYDNNSDD DIEKVVQELD    360
LQGFNVSRKS WPWIKTQEAG FSHCALRARE ECKWVGFFDV DEFFYFPSEF RLNLREGVPG    420
ENSLRSVVAN FSSSKSIAEI RTACHSFGPS GLHSPPKQGV TLGYTCRLQS PERHKSIVRP    480
DLLDISLLNV VHHFQLRQGF RYHNMPEGTA IVNHYKYQVW ETFKAKFFRR VATYVVDWQE    540
DQNKGSKDRA PGLGTEAIEP PNWRLQFCEV WDTGLKDFLL SNFADPATGL MPWERSSL*     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13704Glyco_tranf_2_41.0e-732141696+
pfam01697Glyco_transf_921.0e-40310564274+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK95005.1015961599unknown [Populus trichocarpa]
RefSeqXP_002271877.1015981601PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312696.1015961599predicted protein [Populus trichocarpa]
RefSeqXP_002315701.1015961592predicted protein [Populus trichocarpa]
RefSeqXP_002520193.1015961576ubiquitin-protein ligase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
2143
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GW8919302523385890
FS5893352552444960
EL3687172753215950
CO0716892552815350
CO9843412703085770
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00172.1Aquca_002_00375.1
Arabidopsis lyrata493908484521
Arabidopsis thalianaAT5G40720.1
Brachypodium distachyonBradi3g14080.1
Brassica rapaBra028472Bra025268
Carica papayaevm.model.supercontig_5.316
Citrus clementinaCiclev10030976m
Citrus sinensisorange1.1g043544morange1.1g037991m
Cucumis sativusCucsa.136130.1
Eucalyptus grandisEucgr.B03384.1
Glycine maxGlyma02g03040.1Glyma01g04515.1Glyma08g40440.1
Gossypium raimondiiGorai.009G345800.1Gorai.006G037600.1
Manihot esculentacassava4.1_034265mcassava4.1_007462m
Mimulus guttatusmgv1a001120mmgv1a003136m
Panicum virgatumPavirv00056779m
Phaseolus vulgarisPhvul.008G147000.1
Ricinus communis29736.m002092
Selaginella moellendorffii102746
Sorghum bicolorSb07g002140.1
Vitis viniferaGSVIVT01003965001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny