y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G098000.2
FamilyGT76
Protein PropertiesLength: 457 Molecular Weight: 51539.2 Isoelectric Point: 8.7321
ChromosomeChromosome/Scaffold: 02 Start: 18967749 End: 18972186
Descriptiontransferases, transferring hexosyl groups
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT76264560
  VLKSAICSRLLLLAMIILFRTILSPYDTSASLNPPCLSTPNATLSSPLQNAVVWDSVYFLRIAQCGYEYEQTFAFLPLLPLSLSLLSFLPTQTPLFILSA
  YLINNLAFVLAALYFYRLSLTLLKDPQTALRATLLFCFNPASVFYSSIYSESLYALMCFGGMYHFVCGGNNLAVLFFALSGCARSNGVLNAGYLCFQTMH
  RSFHALFHQKRLPLALQIIFVGALRTACIFAPFLAFQAYGYYNICVGRSRDEIRPWCKARIPLLYSYIQSKYWPQTFFSLGFLAPMEEKSCGVVFLSADL
  SRSKEAGSVGKSSSVRVEEHLNLRRRKNVIKGDVATVPIESESAEAWPGYLSASVLPFLLHLGFMACTAFFVMHVQVATRFLSASPPLYWFAAYIMAYPT
  KYYRWGYVIWAYSITYIFLGSLLFSNFYPFT
Full Sequence
Protein Sequence     Length: 457     Download
MRGDSYSKMV ETSAEHEHEH LHQHLVLKSA ICSRLLLLAM IILFRTILSP YDTSASLNPP    60
CLSTPNATLS SPLQNAVVWD SVYFLRIAQC GYEYEQTFAF LPLLPLSLSL LSFLPTQTPL    120
FILSAYLINN LAFVLAALYF YRLSLTLLKD PQTALRATLL FCFNPASVFY SSIYSESLYA    180
LMCFGGMYHF VCGGNNLAVL FFALSGCARS NGVLNAGYLC FQTMHRSFHA LFHQKRLPLA    240
LQIIFVGALR TACIFAPFLA FQAYGYYNIC VGRSRDEIRP WCKARIPLLY SYIQSKYWPQ    300
TFFSLGFLAP MEEKSCGVVF LSADLSRSKE AGSVGKSSSV RVEEHLNLRR RKNVIKGDVA    360
TVPIESESAE AWPGYLSASV LPFLLHLGFM ACTAFFVMHV QVATRFLSAS PPLYWFAAYI    420
MAYPTKYYRW GYVIWAYSIT YIFLGSLLFS NFYPFT*                             480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5542COG55428.0e-11122298180+
pfam04188Mannosyl_trans24.0e-8330456447+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0006506GPI anchor biosynthetic process
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC17633.1074562492Contains similarity to hypothetical protein C18b11.05 gb
GenBankABC75356.1094561486Protein of unknown function DUF409 [Medicago truncatula]
RefSeqNP_172652.2074562489transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002283435.102245611497PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002527781.10224568500conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
3049
118140
160182
197219
239261
375397
406423
433455
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CV5336022171223380
HO7830321841743200
HO7830321113014110
BX839527276282870
BE0218631491462940
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00449.3Aquca_013_00449.2Aquca_013_00449.1
Arabidopsis lyrata471336
Arabidopsis thalianaAT1G11880.1
Brachypodium distachyonBradi4g06960.1
Brassica rapaBra031787Bra016807
Carica papayaevm.model.supercontig_1833.2
Capsella rubellaCarubv10008966m
Chlamydomonas reinhardtiiCre07.g320650.t1.3
Citrus clementinaCiclev10015009m
Citrus sinensisorange1.1g018572morange1.1g020868morange1.1g022022morange1.1g011059m
Cucumis sativusCucsa.142860.1Cucsa.142850.1
Eucalyptus grandisEucgr.F02225.1
Fragaria vescamrna24756.1-v1.0-hybrid
Glycine maxGlyma07g34710.2Glyma07g34710.1
Gossypium raimondiiGorai.011G002800.4.154.470Gorai.011G002800.6Gorai.011G002800.3Gorai.011G002800.2Gorai.011G002800.4.154.470
Gorai.011G002800.5Gorai.011G002800.4.21.155Gorai.011G002800.1Gorai.011G002800.4.21.155
Linum usitatissimumLus10000535
Malus domesticaMDP0000302238MDP0000268496MDP0000210920MDP0000206274MDP0000255613
MDP0000165902
Manihot esculentacassava4.1_021982mcassava4.1_013936m
Medicago truncatulaMedtr4g084070.1
Mimulus guttatusmgv1a006152m
Oryza sativaLOC_Os12g31480.1
Panicum virgatumPavirv00004639mPavirv00008794m
Physcomitrella patensPp1s58_115V6.1
Phaseolus vulgarisPhvul.009G191800.1Phvul.002G098000.1
Picea abiesMA_93868g0010MA_10427477g0010
Populus trichocarpaPotri.003G216900.1Potri.003G216900.3Potri.003G216900.2Potri.003G216900.4Potri.003G216900.5
Prunus persicappa004654m
Ricinus communis29692.m000527
Setaria italicaSi021856m
Selaginella moellendorffii268247
Sorghum bicolorSb03g024000.1
Thellungiella halophilaThhalv10007452m
Vitis viniferaGSVIVT01025407001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny