y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G107300.1
FamilyGH38
Protein PropertiesLength: 1007 Molecular Weight: 113653 Isoelectric Point: 8.0156
ChromosomeChromosome/Scaffold: 02 Start: 21656943 End: 21668411
DescriptionGlycosyl hydrolase family 38 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH38413520
  NVHLVAHSHDDVGWLKTVDQYYVGSNNNIQGACVENVLDSVVMSLQRDQNRKFVFAEMAFFSRWWVEQTPQIQAQVTKLVNAGQLEFVNGGWCMHDEAAT
  HYVDMIDQTTLGHRFIKNQFNKVPRAGWQIDPFGHSAVQAYLLGAELGFDSVHFARIDYQDRDKRKVDKTLEVVWRGSKTFGSSSQIFANTFPVHYGPPR
  GFHFEVNDNLVPVQDDPLLFDYNVDQRVQDFVAAAITQANVTRTNHIMWTMGDDFQYQYAENWFRQMDKLIHHVNKDGRVNALYSTPSIYTDAKNAANQQ
  WPLKIDDYYPYA
Full Sequence
Protein Sequence     Length: 1007     Download
MSERMTIVSE CFFVFLLLCL CGSVVCVKYN TGASIVPGKL NVHLVAHSHD DVGWLKTVDQ    60
YYVGSNNNIQ GACVENVLDS VVMSLQRDQN RKFVFAEMAF FSRWWVEQTP QIQAQVTKLV    120
NAGQLEFVNG GWCMHDEAAT HYVDMIDQTT LGHRFIKNQF NKVPRAGWQI DPFGHSAVQA    180
YLLGAELGFD SVHFARIDYQ DRDKRKVDKT LEVVWRGSKT FGSSSQIFAN TFPVHYGPPR    240
GFHFEVNDNL VPVQDDPLLF DYNVDQRVQD FVAAAITQAN VTRTNHIMWT MGDDFQYQYA    300
ENWFRQMDKL IHHVNKDGRV NALYSTPSIY TDAKNAANQQ WPLKIDDYYP YADEPHAYWT    360
GFYTSRPAFK RYVRILSGYY LAARQLEFFA GKKSTTSHTL DLGDALGIAQ HHDAVSGTAK    420
QHTTDDYAKR LAIGASRVED VVSSSLYCLT RTKLGGQCTT PTSAFSQCQL LNISYCPATE    480
DSIPQANSLV LVVYNTLGWN RTEIVRIPVN DANLVVKDSL GNNVQTQYIE VDNVTANLRE    540
IYVKAYLGVS PKQAPKYWLV FQASVPPLGW STYFISKIAM RVESRNGFLS HHTTSQRNDI    600
IEVGPGNLKL SFSAKSGQLI RMHNSRTGVD VPIQQSYLWY SSSVSVCLLS GAYIFQPDSP    660
AHIVSKSVMP IKIIRGPLVD EVHQNFSSWI YQITRVYKDK EHAEIEYTIG PIPMGFGVGK    720
DVITQLTTNM LTNKEFYTDS NGRDFLKRVR DYREDWPLKV TEPVAGNYYP LNLGIYIKDN    780
KSELSILVDR ATGGGSIKDG QVELMLHRRM QSDDGRGVGE GLNEQVCQNN KCQGLRVRGN    840
YHVAIHNLTA GSRWRRTTGQ EIYSPLLLAF SQEKMGNWKA SHVTKGTLID PNYSLPPNVA    900
LITLEELDNR MVLLRLAHLY ESGEDVQLST LTKVELKKLF ITKTIKQLTE VSLSANQERS    960
KMKKKTWKVE GDKGQESKAV RGGPVSQISL LVELGPMEIR TFLLEF*                  1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd10809GH38N_AMII_GMII_SfManIII_like3.0e-7339363355+
pfam01074Glyco_hydro_381.0e-9041352316+
PLN02701PLN027012.0e-10639822868+
cd00451GH38N_AMII_euk3.0e-10840316277+
cd10810GH38N_AMII_LAM_like2.0e-17240316279+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC66555.10291006271004hypothetical protein OsI_32713 [Oryza sativa Indica Group]
RefSeqNP_001064140.10291006271004Os10g0140200 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002265360.1013100691006PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303405.10161006211011predicted protein [Populus trichocarpa]
RefSeqXP_002464752.10341006341007hypothetical protein SORBIDRAFT_01g026390 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1o7d_A0293223298C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB1hxk_A02782238852A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A02782238852A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hty_A02782238852A Chain A, Golgi Alpha-Mannosidase Ii
PDB3eju_A02782268882A Chain A, Golgi Alpha-Mannosidase Ii
Transmembrane Domains
StartEnd
1234
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7800626023339290
HO780062862483330
FG2273944951896770
GO856108340914300
HO780062234124342.3
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.2Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.001G084700.1Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)