y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G122000.1
FamilyGT77
Protein PropertiesLength: 627 Molecular Weight: 71713.3 Isoelectric Point: 5.9392
ChromosomeChromosome/Scaffold: 02 Start: 24653342 End: 24663158
Descriptionxyloglucanase 113
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771413650
  VSNFLVGAMDTKLLEALYWKGIPVFDMGSHMSTEDVGWGSPKFHKMGREKVILINLILPFGYELLMCDTDMVWLKNPLPYLARYPGADVLTSSDQVVPTV
  VDDSLEIWQEVGAAYNIGIFHWRPTESAKKLAKEWKELLLADDKIWDQNGFNEIIHRQLGPSVDEDSGLVYAYDGNLKLGILPSSIFCSGHTYFVQAMYQ
  QLRLEPYAVHTTFQYAGTEGKRHRL
Full Sequence
Protein Sequence     Length: 627     Download
MACEEVLHSR PLFLTIYTVV IIGIVFSSFY VFSAIRYPST NPSSWSLSNE DVRLTEQTLN    60
GSRFATVDVP SVPPEARDVR TRPILDVPPR NKEMPPLEAF GLTKELIQKR VKDNVIIVTF    120
ANYAFMDFIL TWVQQLNNLE VSNFLVGAMD TKLLEALYWK GIPVFDMGSH MSTEDVGWGS    180
PKFHKMGREK VILINLILPF GYELLMCDTD MVWLKNPLPY LARYPGADVL TSSDQVVPTV    240
VDDSLEIWQE VGAAYNIGIF HWRPTESAKK LAKEWKELLL ADDKIWDQNG FNEIIHRQLG    300
PSVDEDSGLV YAYDGNLKLG ILPSSIFCSG HTYFVQAMYQ QLRLEPYAVH TTFQYAGTEG    360
KRHRLREAMF FHDPPEYYNP SGGFLSFKPS IPKSLLLSGN HTIESHFTLV NYQIKQIRAA    420
LAIASLLNRT LVVPPLWCRV DRLWFPHPGV LEGSMTRQPF LCPLDHVFEV NAMLKELPEE    480
EFGPGIDIRE YSLLDNPSLP SEVKKSWLDV HLCKEGTQDC VASNNTSIGG VLKFPRHSNE    540
ETYMKIFSSF KDIKVIQFSS MQDAFTGFSD KEREDKFRKR VKRYVGIWCC VLDHTPGHIY    600
YDMYWDEKPE WKPLPPQTSA DDHPPW*                                        660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans3.0e-40141365231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29197.107762694642unnamed protein product [Vitis vinifera]
RefSeqNP_850250.107562593643unknown protein [Arabidopsis thaliana]
RefSeqXP_002269181.1077626163711PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328759.105862672638predicted protein [Populus trichocarpa]
RefSeqXP_002519934.1026267639reticulon3-A3, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX1308722951844780
EV2351133251724940
DT5119933041154180
GR7084012981274240
DY9701412793416190
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)