y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G124600.1
FamilyGT4
Protein PropertiesLength: 488 Molecular Weight: 54879 Isoelectric Point: 8.1079
ChromosomeChromosome/Scaffold: 02 Start: 25088917 End: 25090380
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT43074445.3e-24
  VLGVAGRLVKDKGHPLLHEAYSRLITKHPNVYLIVAGSGPWENRYRDLGNQVLVLGSMSPSMLRAFYNAIDIFVNPTLRPQGLDLTLMEAMMSGKPLLAS
  RFPSIKGSVVVDDEFGFMFSPNVESLMEALEAVVKEGK
Full Sequence
Protein Sequence     Length: 488     Download
MAFNNKSKKS SSPSNFTFCV TLFFLVLFTI PAFFLLHTPT TCTTLSKTWS GDLLLAKFAW    60
NKLPFLEHNP SPLPLKIAVF SRKWPIGTTP GGMERHAYTL HTALAQRGHK VHIFTSPPEE    120
ETTSTFSSDT TNHQADVNAP SSPFIHCHEG EPGKWRYNKA WEQFLEQNQK EPFDVVHSES    180
VALPHWLARD LPNLAVSWHG IALESLQSSL FQDLARRTDE PRSPDFDKGL QGVLPKILNE    240
IRFFRNYAHH VAISDSCGEM LRDVYQIPSR RVHVILNGVD EGDFREDVEL GREFRTKIGI    300
PSNASLVLGV AGRLVKDKGH PLLHEAYSRL ITKHPNVYLI VAGSGPWENR YRDLGNQVLV    360
LGSMSPSMLR AFYNAIDIFV NPTLRPQGLD LTLMEAMMSG KPLLASRFPS IKGSVVVDDE    420
FGFMFSPNVE SLMEALEAVV KEGKVGLARR GKACREYAIS MFTATKMALA YERLFLCIKE    480
DKFCNYY*                                                             540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0438RfaG7.0e-3076482416+
cd03807GT1_WbnK_like8.0e-33242475243+
cd03811GT1_WabH_like1.0e-3491464384+
cd03798GT1_wlbH_like1.0e-4091475399+
cd03801GT1_YqgM_like1.0e-5776475412+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002271072.1014861492PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002271108.1014861491PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303479.1014871489predicted protein [Populus trichocarpa]
RefSeqXP_002326600.1014861487predicted protein [Populus trichocarpa]
RefSeqXP_002519899.1014862485glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3c4v_B0.0000019142522353A Chain A, Crystal Structure Of N-Terminal Domain Of Human Galectin-8
PDB3c4v_A0.0000019142522353A Chain A, Crystal Structure Of N-Terminal Domain Of Human Galectin-8
PDB3c4q_B0.0000019142522353A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c4q_A0.0000019142522353A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c48_B0.0000029142542373A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure.
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AM7324152861684530
CO9850292242634860
GR1862222611804400
FG1633432582304860
GO0171281972904860
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00071.1Aquca_004_00554.1
Arabidopsis lyrata316266919149492915
Arabidopsis thalianaAT1G73160.1AT5G59070.1AT4G19460.1
Brachypodium distachyonBradi2g45370.1
Brassica rapaBra012542Bra003857Bra013399Bra020331
Carica papayaevm.model.supercontig_305.3
Capsella rubellaCarubv10004612mCarubv10021524m
Citrus clementinaCiclev10008126mCiclev10003490m
Citrus sinensisorange1.1g039338morange1.1g044542m
Cucumis sativusCucsa.268510.1
Eucalyptus grandisEucgr.E01172.1Eucgr.F03250.1
Fragaria vescamrna27708.1-v1.0-hybridmrna27178.1-v1.0-hybrid
Glycine maxGlyma09g34990.1Glyma01g35440.1Glyma16g17250.1Glyma16g08210.1
Gossypium raimondiiGorai.009G372800.1Gorai.008G217900.1
Linum usitatissimumLus10032187Lus10014499Lus10033297Lus10034760
Malus domesticaMDP0000252217MDP0000510770MDP0000280727MDP0000690085
Manihot esculentacassava4.1_023608mcassava4.1_022788m
Medicago truncatulaMedtr5g026360.1Medtr8g071900.1
Mimulus guttatusmgv1a005617mmgv1a027119m
Oryza sativaLOC_Os01g46430.1
Panicum virgatumPavirv00039421mPavirv00050283m
Physcomitrella patensPp1s115_97V6.1Pp1s115_97V6.2Pp1s231_59V6.1
Phaseolus vulgarisPhvul.003G277200.1
Picea abiesMA_159118g0690MA_58772g0010
Populus trichocarpaPotri.011G097000.1Potri.003G105500.1Potri.001G128300.1
Prunus persicappa004871mppa024212m
Ricinus communis30150.m00047029827.m002616
Setaria italicaSi001150m
Selaginella moellendorffii79637
Sorghum bicolorSb03g029770.1
Thellungiella halophilaThhalv10013459mThhalv10027268mThhalv10019571m
Vitis viniferaGSVIVT01036920001GSVIVT01036921001GSVIVT01036924001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny