y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G145000.1
FamilyCBM57
Protein PropertiesLength: 1054 Molecular Weight: 119184 Isoelectric Point: 7.0319
ChromosomeChromosome/Scaffold: 02 Start: 28162798 End: 28168643
DescriptionDi-glucose binding protein with Kinesin motor domain
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM57592015.5e-33
  MFVNAGGDAFSEAAGATFLGDTYFDGGNVMRTDERIVEGGDYPFIYQSARLGSFCYRFDNIPPGDYVVDLHFVEIININGPKGMRVFNVYIQDEKVLSEL
  DIYAIVGANKPLQLVDSSVSVKDDGVILIRFEGISGSPVVSGI
Full Sequence
Protein Sequence     Length: 1054     Download
MDPIQTNDVH EYPQTLFSEP NDSLMQDANE SLFDSMVCDP TSRLIPTGFT RKTEEECFMF    60
VNAGGDAFSE AAGATFLGDT YFDGGNVMRT DERIVEGGDY PFIYQSARLG SFCYRFDNIP    120
PGDYVVDLHF VEIININGPK GMRVFNVYIQ DEKVLSELDI YAIVGANKPL QLVDSSVSVK    180
DDGVILIRFE GISGSPVVSG ICIRRETKAS VPQVTSDHIK CSHCAAQIEI PSSQMKVMQA    240
KSTAKYESKI NELKMQCEIK AKECYEAWMS LTATNEQLET VQMELDNVTI KSHTTDQTVE    300
KQAESLRNIS NRYELDKKKW ADAIYSLQEK IKLMKSDYLK LSFEAHECVD SIPELNKMVF    360
AVQELVKQCE DLKVKYNEEM TKRKKLFNEV QEAKGNIRVF CRCRPLNKAE ISAGYNTVVD    420
FDAAKDGCLG ILTSGSVKKP FRFDRVYTPK DDQVDVFADA SSMVISVLDG YNVCIFAYGQ    480
TGTGKTFTME GTQLNRGVNY RTLEHLFKVS KERSETFSYD ISVSVLEVYN EQIRDLLATG    540
QTSKRLEIKQ ASEGFHHVPG VVEAKIDSIN EVWNVLQTGN NARAVGSNNI NEHSSRSHCM    600
LCITVKAKNL LNGDCTKSKL WLVDLAGSER LAKTEAQGER LKEAQNINRS LSALGDVISA    660
LAAKSSHIPY RNSKLTHLLQ DSLGGDSKTL MLVQISPSDQ DLGETLSSLN FATRVRGVEV    720
GPVKKQIDTS ELQKLKAMLE KARSDCRTKD ESMRKLEENF QSLESKAKGK DQIYKNLQEK    780
IKELEELNKA TQSESEKQIS QLSDKLRGKE ETCSSLQQKV RELEKRMKEQ LQSESASFQQ    840
KVRDLEKRLK DQMQGSESES AILKDKIKEL ERKLREQEQS SMSMIHQQMK ELEDRYRERE    900
QQWQCREREQ QWQQTQSYVD AVKATPDIGK SFMNEECPSE IEAGILRCSD SVNRQISQGS    960
SLFKGSDSTN KIRSKTRGFR SNDENNFVMS SSLHDRKVTR KSDPPKIVRS VRPTPRPATA    1020
NNQAPVSHKR ASTSRDQVQG IRERESKKKI WSR*                                1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01369KISc_KHC_KIF52.0e-103396714324+
cd00106KISc8.0e-120396716329+
smart00129KISc1.0e-130396724336+
pfam00225Kinesin6.0e-136402718326+
cd01366KISc_C_terminal1.0e-175394721330+
Gene Ontology
GO TermDescription
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0007018microtubule-based movement
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN63715.1018501884hypothetical protein [Vitis vinifera]
EMBLCBI40845.10768513785unnamed protein product [Vitis vinifera]
EMBLCBI40845.12e-199171053850979unnamed protein product [Vitis vinifera]
RefSeqXP_002266404.1018341871PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002266404.15e-248021053737982PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2h58_A03937202330A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3h4s_A03837721383A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_C03917581368A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_A03917581368A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cnz_B03917581368A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL4429302664827450
FL9216582584867430
EH1942273175298400
DV9908453024507470
ES8650562874637450
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00213.1Aquca_015_00213.2
Arabidopsis thalianaAT2G22610.1AT2G22610.2
Brassica rapaBra038507Bra016076
Carica papayaevm.model.supercontig_229.5evm.model.supercontig_21.41
Capsella rubellaCarubv10022542mCarubv10022541m
Citrus clementinaCiclev10000147mCiclev10024772m
Citrus sinensisorange1.1g037169morange1.1g001679m
Fragaria vescamrna20704.1-v1.0-hybridmrna26561.1-v1.0-hybrid
Glycine maxGlyma01g02620.1Glyma09g33340.2
Gossypium raimondiiGorai.008G093800.1Gorai.009G228400.1Gorai.002G032500.3Gorai.002G032500.2Gorai.002G032500.1
Linum usitatissimumLus10005582Lus10035954Lus10025708Lus10013714
Malus domesticaMDP0000317970
Manihot esculentacassava4.1_032042mcassava4.1_000724m
Medicago truncatulaAC174330_12.1AC146711_18.1AC146711_37.1Medtr5g031470.1
Mimulus guttatusmgv1a000533m
Physcomitrella patensPp1s9_137V6.1Pp1s403_54V6.1
Picea abiesMA_180169g0010
Populus trichocarpaPotri.002G110600.2Potri.011G140000.1Potri.001G436200.1Potri.001G436200.2Potri.001G436200.4
Potri.002G110600.1
Prunus persicappa014706mppa015110m
Ricinus communis29591.m00013929235.m00023229596.m000713
Selaginella moellendorffii13900998850
Vitis viniferaGSVIVT01003948001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny