y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G188500.1
FamilyGT77
Protein PropertiesLength: 358 Molecular Weight: 40360.8 Isoelectric Point: 9.0148
ChromosomeChromosome/Scaffold: 02 Start: 34370884 End: 34375760
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771213370
  DMVLVIAEDYASLHRVNDLWPGHAVLIPPVLDAEAAHKFGSQGFFNFTARRPSHLLKILELGYSVMYNDVDMVWLADPFPYLLGNHDVYFTDDMTAIKPL
  NHSHDLPPPGKKGRPYICSCMIFLRPTDAAKLVLKKWIEELQIQPWSKTVKSNDQPAFNWALMKIAKEVDLYLLPQAAFPTGGLYFKNKTWVKETKGNHV
  IIHNNYIVGFEKKIKRF
Full Sequence
Protein Sequence     Length: 358     Download
MSSFLHQRSL QNPFSNPFPI SAPSSANSKR PFSSILGPTT LLALLSLVVI VGVFCPWVGM    60
PQAFSFTSTS TSASKWDHYT LQQALSFVAR NGSLIVCIVS QPYLPFLNNW LISITMQNRQ    120
DMVLVIAEDY ASLHRVNDLW PGHAVLIPPV LDAEAAHKFG SQGFFNFTAR RPSHLLKILE    180
LGYSVMYNDV DMVWLADPFP YLLGNHDVYF TDDMTAIKPL NHSHDLPPPG KKGRPYICSC    240
MIFLRPTDAA KLVLKKWIEE LQIQPWSKTV KSNDQPAFNW ALMKIAKEVD LYLLPQAAFP    300
TGGLYFKNKT WVKETKGNHV IIHNNYIVGF EKKIKRFRDY GLWLVDDHAH ESPLGAL*      360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-37123337220+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ94713.1013571357putative alpha 1,3-xylosyltransferase [Linum usitatissimum]
EMBLCAN69309.10483571309hypothetical protein [Vitis vinifera]
RefSeqNP_849279.1023574359unknown protein [Arabidopsis thaliana]
RefSeqXP_002273155.101535720360PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002511939.1013571356conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
3254
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY29448336113560
DY264723280563350
FC914138271563260
DY26803634313410
DY264723243303530.66
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_074_00044.1
Arabidopsis lyrata352664892838490401474813912111
Arabidopsis thalianaAT4G01220.1AT1G56550.1AT4G01750.1AT4G01220.2AT4G01770.1
Brachypodium distachyonBradi2g26850.1
Brassica rapaBra035432Bra036306Bra000906Bra039864Bra017900
Bra037377Bra000950Bra035431Bra000907
Carica papayaevm.model.supercontig_184.13
Capsella rubellaCarubv10001259mCarubv10001249mCarubv10021691m
Citrus clementinaCiclev10020808mCiclev10022071mCiclev10021218m
Citrus sinensisorange1.1g018302morange1.1g027009morange1.1g021054m
Cucumis sativusCucsa.135840.2Cucsa.135840.1
Eucalyptus grandisEucgr.E00084.1
Fragaria vescamrna09360.1-v1.0-hybrid
Glycine maxGlyma08g09360.1
Gossypium raimondiiGorai.004G154200.4Gorai.007G104400.1Gorai.004G154200.1Gorai.004G154200.5Gorai.004G154200.3
Gorai.004G154200.2
Linum usitatissimumLus10002153Lus10012650Lus10008735
Malus domesticaMDP0000150593MDP0000264889
Manihot esculentacassava4.1_010616mcassava4.1_010633m
Mimulus guttatusmgv1a008876m
Oryza sativaLOC_Os05g32120.1
Panicum virgatumPavirv00063401mPavirv00048789m
Physcomitrella patensPp1s19_296V6.1
Picea abiesMA_10233136g0010MA_173768g0010
Populus trichocarpaPotri.014G092400.2Potri.002G166000.1Potri.014G092400.1
Prunus persicappa007793m
Ricinus communis30174.m008682
Setaria italicaSi022588mSi017632m
Selaginella moellendorffii87970
Sorghum bicolorSb09g019070.1
Thellungiella halophilaThhalv10029467mThhalv10015591mThhalv10024021mThhalv10024115mThhalv10028748m
Vitis viniferaGSVIVT01016220001GSVIVT01027019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny