y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G230800.1
FamilyCBM57
Protein PropertiesLength: 625 Molecular Weight: 69330.9 Isoelectric Point: 8.0295
ChromosomeChromosome/Scaffold: 02 Start: 39662504 End: 39668618
Descriptionreceptor like protein 4
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572283595e-23
  TFGEDSESGQPRSVETRIKHASHPPNFYPETLYQSALVSTNNQPDLTYTLEVDPNRNYSVWLHFAEIDYSAGQRIFDIEINGDLAFKHVDIVELSGDVYT
  ALVLNTTVAVNGRSLTIKLKPREGNLAIINAI
Full Sequence
Protein Sequence     Length: 625     Download
MFLQFLQLWM MLCFATVSCA ARQDPFAMRL SCGARQNVQT RPTNTHWRED FGYTGGIVSN    60
ATRPSYITPP LNTLRYFPLS EGPQNCYIID KVPKGHYSIR IFFGLVRQSR GTLIEPLFDI    120
SIEGTQIYSL KSGWTHQADQ VFAEALVFLT DDSVSICFHS TGHGDPAILS IEILQIDDKA    180
YYFAPPWSQG LILRTIKRLS CGFGQSKFDV DYAGDPWGGD RFWQRIKTFG EDSESGQPRS    240
VETRIKHASH PPNFYPETLY QSALVSTNNQ PDLTYTLEVD PNRNYSVWLH FAEIDYSAGQ    300
RIFDIEINGD LAFKHVDIVE LSGDVYTALV LNTTVAVNGR SLTIKLKPRE GNLAIINAIE    360
IFEVIMAESK TISEEVSALQ ALKKALRLPP RFGWNGDPCV PPQHPWSGVD CQLNKSRGSW    420
IIDGLGLDNQ GLKGFLPDDI SRLLNLQILN LSRNNIHGAI PSSLGTINSL QVLDLSYNFF    480
NGSIPESLGQ LSSLQRLNLN SNLLSDRVPA TLGGRLLYRA SFNFTDNAGL CGIPGLPTCG    540
SHLSAGGKIG IGLGASFTIF LLTTCSVCWW KRRKNILRSQ QIAGRAAPYA KARTHFSRDI    600
QMTRHHNNFG KTSTAAENGP ILLS*                                          660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11721Malectin0.00528171159+
PLN00113PLN001135.0e-9373485138+
pfam11721Malectin1.0e-14198359179+
pfam12819Malectin_like4.0e-6630364350+
PLN03150PLN03150015624614+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI30598.102562424624unnamed protein product [Vitis vinifera]
RefSeqNP_174156.102162422626AtRLP4 (Receptor Like Protein 4); protein binding [Arabidopsis thaliana]
RefSeqXP_002279791.10286241600PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305781.10286241596predicted protein [Populus trichocarpa]
RefSeqXP_002509445.1016245629serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3rj0_A0.000000000002397539608745A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB3rj0_A0.000000006422512465555A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB3rj0_A0.000002425512396483A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB3rj0_A0.00002432513451532A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB3rj0_A0.00002446512393459A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Transmembrane Domains
StartEnd
551570
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX133552282142950
EL4027712712074740
DT4818942683195860
DT3378812982895830
DV1616812722114790
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1
Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)