y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G243400.1
FamilyGT57
Protein PropertiesLength: 382 Molecular Weight: 43677.1 Isoelectric Point: 8.9574
ChromosomeChromosome/Scaffold: 02 Start: 41008809 End: 41015964
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT5713600
  MRWTVLSSDALIFFPAVVYFIVVHYNQPSRSHKSELLWHTAVLLLSPCLILIDHGHFQFNCISLGFSVGAVAAILSGKDLVGSVLYCLALNHKQMSAYFA
  PAFFSHLLGKCLRRKHPILEVLKLGLFVLGTFAAVWWPYLYSTQSILEVLSRLAPFERGLFEDYVANFWCASSVVVKWKRLFTTESLKLISFTATVITCL
  PSMIQQIRSPSHRGFLYALLNSSFSFYLFSFQVHEKSILLPLLPATLLAVEEPFIFKWLTQFAMLSMFPLICRDNLVVAYLALLALFFLILNAPVQHRVR
  ESNHLSNYMGSATMFLILCCYFVLHIVYLTMHPPEKYPFLFEAIIMNLCFSQFVLVTLAC
Full Sequence
Protein Sequence     Length: 382     Download
MRWTVLSSDA LIFFPAVVYF IVVHYNQPSR SHKSELLWHT AVLLLSPCLI LIDHGHFQFN    60
CISLGFSVGA VAAILSGKDL VGSVLYCLAL NHKQMSAYFA PAFFSHLLGK CLRRKHPILE    120
VLKLGLFVLG TFAAVWWPYL YSTQSILEVL SRLAPFERGL FEDYVANFWC ASSVVVKWKR    180
LFTTESLKLI SFTATVITCL PSMIQQIRSP SHRGFLYALL NSSFSFYLFS FQVHEKSILL    240
PLLPATLLAV EEPFIFKWLT QFAMLSMFPL ICRDNLVVAY LALLALFFLI LNAPVQHRVR    300
ESNHLSNYMG SATMFLILCC YFVLHIVYLT MHPPEKYPFL FEAIIMNLCF SQFVLVTLAC    360
NIKQWLLKKP AKLEEIEKKF I*                                             420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg81.0e-621353362+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC79743.101372136509putative alpha 3 glucosyltransferase [Oryza sativa Japonica Group]
RefSeqNP_001145139.101379138518hypothetical protein LOC100278369 [Zea mays]
RefSeqXP_002280181.101381138516PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305159.101379109489predicted protein [Populus trichocarpa]
RefSeqXP_002329281.101379105484predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
423
3658
6890
118140
214231
238256
276295
308330
340362
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DN62033227222730
EC986613303843820
GE608284231442740
JG86432027812740
DT648806246292740
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00849.3Aquca_007_00849.4Aquca_007_00849.2Aquca_007_00849.1
Arabidopsis lyrata494131
Arabidopsis thalianaAT5G38460.2AT5G38460.1
Brachypodium distachyonBradi1g63540.1
Brassica rapaBra028183
Capsella rubellaCarubv10004565m
Chlamydomonas reinhardtiiCre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572Cre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572
Citrus clementinaCiclev10011466mCiclev10011636mCiclev10012149m
Citrus sinensisorange1.1g021456m
Cucumis sativusCucsa.031380.1
Eucalyptus grandisEucgr.F02485.1Eucgr.F02485.2.50.327Eucgr.F02485.2.50.327Eucgr.F02485.2.327.474Eucgr.F02485.2.327.474
Fragaria vescamrna11817.1-v1.0-hybrid
Glycine maxGlyma13g07560.1
Gossypium raimondiiGorai.006G229700.2Gorai.006G229700.1
Linum usitatissimumLus10017594Lus10033554
Malus domesticaMDP0000909996MDP0000278459MDP0000180745MDP0000308736
Manihot esculentacassava4.1_009619mcassava4.1_005541m
Mimulus guttatusmgv1a004432m
Oryza sativaLOC_Os07g07010.1
Panicum virgatumPavirv00049296mPavirv00013587mPavirv00013588m
Physcomitrella patensPp1s290_38V6.3Pp1s290_38V6.2Pp1s290_38V6.1
Phaseolus vulgarisPhvul.004G064500.1Phvul.002G243400.2
Picea abiesMA_111087g0010
Populus trichocarpaPotri.017G114100.2Potri.004G100500.1Potri.017G114100.1
Prunus persicappa004184m
Ricinus communis30205.m001578
Setaria italicaSi036186mSi035197m
Selaginella moellendorffii114109
Sorghum bicolorSb01g036460.2.41.351Sb01g036460.2.41.351Sb01g036460.1Sb01g036460.2.352.477Sb01g036460.2.352.477
Thellungiella halophilaThhalv10017711mThhalv10027717m
Vitis viniferaGSVIVT01031043001
Volvox carteriVocar20001407m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny