y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G270900.1
FamilyCE8
Protein PropertiesLength: 545 Molecular Weight: 58906.4 Isoelectric Point: 6.4211
ChromosomeChromosome/Scaffold: 02 Start: 43597159 End: 43599644
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82265300
  VTVCKNGADGCYKTIQEAVNAAPDNGDGKKRFVILIKEGVYKETVRIPLAKRNVVFLGDGIGKTVITGDANVGLQAMTTYNSATVAVLGDGFMAKDLTIE
  NTAGPDAHQAVAFRSDSDLSVIENCEFLGNQDTLYAHSLRQFYKSCRIEGNVDFIFGNSAAVFQDCLVLVRPRQLHPEKGENNAITAHGRTDPSQPTGFV
  FQNCVINGTEEYLALYHSNPKVHKNYLGRPWKEYSRTIFVNSELAVILTPQGWMPWSGDFALKTLYYGEFGNKGPGSDLSQRVSWSSKIPQDHILAYSVQ
  NFIQG
Full Sequence
Protein Sequence     Length: 545     Download
MDYLFFLSLF LLLTLSAAHR KAPPVAAVKS VTQEIQQACA ATRFPQQCQT SLSQYPKLPP    60
NPSSLQFIQA AVAIYSENLA TAQSMVKSLL DNAGGSRNLT MAASTCVEVL DNSNHRTSLA    120
SDALPQGKIK DARAWLGAAL AYQYDCWSGL KYANESAAVG KAMAFIDSLE SLSSNALNMV    180
FSLDAFGNDT ASWKPPVTER DGFWGTIASG DSGPVGGVPP NLKPDVTVCK NGADGCYKTI    240
QEAVNAAPDN GDGKKRFVIL IKEGVYKETV RIPLAKRNVV FLGDGIGKTV ITGDANVGLQ    300
AMTTYNSATV AVLGDGFMAK DLTIENTAGP DAHQAVAFRS DSDLSVIENC EFLGNQDTLY    360
AHSLRQFYKS CRIEGNVDFI FGNSAAVFQD CLVLVRPRQL HPEKGENNAI TAHGRTDPSQ    420
PTGFVFQNCV INGTEEYLAL YHSNPKVHKN YLGRPWKEYS RTIFVNSELA VILTPQGWMP    480
WSGDFALKTL YYGEFGNKGP GSDLSQRVSW SSKIPQDHIL AYSVQNFIQG NDWIPSSSSA    540
TPSS*                                                                600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02713PLN027134.0e-11838534545+
PLN02745PLN027453.0e-11821534541+
PLN02201PLN022016.0e-11953534501+
pfam01095Pectinesterase1.0e-161225531310+
PLN02708PLN02708020534520+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002275192.101753520541PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281640.102453840555PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306241.103553853558predicted protein [Populus trichocarpa]
RefSeqXP_002309906.102053841564predicted protein [Populus trichocarpa]
RefSeqXP_002517239.102353834552Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02225385312A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02255404310B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B2e-202285368340B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A2e-202285368340B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B2e-202285368340B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8014251733625340
HO8014251921703610
GW9018922412945340
EX6715762742615340
GW9009592223135340
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G09760.1AT5G64640.1
Brachypodium distachyonBradi2g56820.1Bradi5g10700.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Carica papayaevm.model.supercontig_42.121
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna26037.1-v1.0-hybridmrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.003G067900.1Gorai.007G064900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004527mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os01g65790.1LOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.009G148900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)