y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G301500.1
FamilyGH37
Protein PropertiesLength: 552 Molecular Weight: 62158.4 Isoelectric Point: 5.4882
ChromosomeChromosome/Scaffold: 02 Start: 46368696 End: 46374844
Descriptiontrehalase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH37305400
  DPKTYVDMPLKFELSVTEDAFQKLPRNAHGIVAVEDLKRFLEAYLGGAGDDLVYLQPHDFVREPEGFLPKVKNPQVRAWALQVHSLWKNLSRKVSAAVQA
  HPDLHTLLPLPGSVVIPGSRFREVYYWDSYWVIRGLIASKMYDTATAIVTNLISLVEQYGFVLNGARAYYTNRSQPPLLSAMVYEIYCTTGDVELVKRSL
  PALLKEYEFWNSEIHKVTILDAQGCPHTLNRYNAMWDKPRPESSTKDKAFASNFSSVSEKQQFYRELASTAESGWDFSTRWMRNPPNFTTVATTSVIPVD
  LNAFLLGMELNIAFFAKVAGDNSTAERFLENSDLRKKAMNSVFWNANMKQWLDFWLENTCEEVHVWKNGHQNQNVFASNFIPLWMNPFYSDTSLVGSVVE
  SLKTSGLVRAAGVATSLTDSGQQWDFPNGWAPLQHMLVEGLLKSGLQEARSLAEEIAIGWVTTNYIVYKKTGSMHEKFNVEHCGEFGGGGEYVPQTGFGW
  SNGVVLAFLEE
Full Sequence
Protein Sequence     Length: 552     Download
MAVTPSTSLL SFLQRLQQTA FEAFGASDFD PKTYVDMPLK FELSVTEDAF QKLPRNAHGI    60
VAVEDLKRFL EAYLGGAGDD LVYLQPHDFV REPEGFLPKV KNPQVRAWAL QVHSLWKNLS    120
RKVSAAVQAH PDLHTLLPLP GSVVIPGSRF REVYYWDSYW VIRGLIASKM YDTATAIVTN    180
LISLVEQYGF VLNGARAYYT NRSQPPLLSA MVYEIYCTTG DVELVKRSLP ALLKEYEFWN    240
SEIHKVTILD AQGCPHTLNR YNAMWDKPRP ESSTKDKAFA SNFSSVSEKQ QFYRELASTA    300
ESGWDFSTRW MRNPPNFTTV ATTSVIPVDL NAFLLGMELN IAFFAKVAGD NSTAERFLEN    360
SDLRKKAMNS VFWNANMKQW LDFWLENTCE EVHVWKNGHQ NQNVFASNFI PLWMNPFYSD    420
TSLVGSVVES LKTSGLVRAA GVATSLTDSG QQWDFPNGWA PLQHMLVEGL LKSGLQEARS    480
LAEEIAIGWV TTNYIVYKKT GSMHEKFNVE HCGEFGGGGE YVPQTGFGWS NGVVLAFLEE    540
FGWPEDRNIE C*                                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13270treF1.0e-84100544459+
PRK13271treA1.0e-8691539457+
COG1626TreA1.0e-98115547445+
PLN02567PLN0256703551554+
pfam01204Trehalase029542521+
Gene Ontology
GO TermDescription
GO:0004555alpha,alpha-trehalase activity
GO:0005991trehalose metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD22970.1015517557AF124148_1 trehalase 1 GMTRE1 [Glycine max]
RefSeqXP_002263698.10355113564PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303674.10355117568predicted protein [Populus trichocarpa]
RefSeqXP_002303675.10355117568predicted protein [Populus trichocarpa]
RefSeqXP_002523413.10355116566alpha,alpha-trehalase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wyn_D09153972500B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2wyn_C09153972500B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2wyn_B09153972500B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2wyn_A09153972500B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2jjb_D09153972500B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9856852273265520
FQ4803532892525370
FQ4526012892525370
CV5375682003535520
FQ4160492862525340
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00232.1Aquca_037_00231.2Aquca_037_00231.1
Arabidopsis lyrata914188
Arabidopsis thalianaAT4G24040.1
Brachypodium distachyonBradi3g31410.3Bradi3g31410.2Bradi3g31410.1
Brassica rapaBra013756Bra019249
Carica papayaevm.model.supercontig_15.13
Capsella rubellaCarubv10006565m
Chlamydomonas reinhardtiiCre03.g195600.t1.2.34.224Cre03.g195600.t1.2.34.224Cre03.g195600.t1.2.267.650Cre03.g195600.t1.2.267.650
Citrus clementinaCiclev10023271mCiclev10033306mCiclev10001132mCiclev10001012mCiclev10001134m
Ciclev10000621mCiclev10000674m
Citrus sinensisorange1.1g041103m.84.216orange1.1g037772m.219.456orange1.1g037772m.219.456orange1.1g047407morange1.1g041103m.217.446
orange1.1g041103m.217.446orange1.1g037772m.86.219orange1.1g037772m.86.219orange1.1g041103m.84.216
Cucumis sativusCucsa.303880.1
Eucalyptus grandisEucgr.E01027.1Eucgr.E01027.2
Fragaria vescamrna25101.1-v1.0-hybrid
Glycine maxGlyma05g36580.2Glyma05g36580.1
Gossypium raimondiiGorai.003G075200.1Gorai.007G020500.2Gorai.007G020500.1
Linum usitatissimumLus10023035Lus10032434Lus10023034Lus10032435
Malus domesticaMDP0000315187.328.541MDP0000235673.82.325MDP0000315187.82.325MDP0000315187.82.325MDP0000235673.82.325
MDP0000235673.328.541MDP0000315187.328.541MDP0000235673.328.541
Manihot esculentacassava4.1_015916mcassava4.1_004491mcassava4.1_023202m
Mimulus guttatusmgv1a003260m
Oryza sativaLOC_Os10g37660.1
Panicum virgatumPavirv00009281mPavirv00064436mPavirv00062867mPavirv00064435m
Physcomitrella patensPp1s196_77V6.1Pp1s194_104V6.3Pp1s116_30V6.1Pp1s194_104V6.2Pp1s194_104V6.1
Pp1s137_159V6.1
Phaseolus vulgarisPhvul.002G301500.2
Picea abiesMA_31368g0020MA_31368g0010
Populus trichocarpaPotri.001G087100.1Potri.003G144000.1Potri.006G068300.1Potri.003G143900.1Potri.001G087100.2
Prunus persicappa003514m
Ricinus communis28842.m00094530068.m002541
Setaria italicaSi034760m
Selaginella moellendorffii90006177119156751109304
Sorghum bicolorSb01g031280.1
Thellungiella halophilaThhalv10024684m
Vitis viniferaGSVIVT01019610001
Volvox carteriVocar20003462m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny