y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G319500.2
FamilyGH17
Protein PropertiesLength: 353 Molecular Weight: 38221.5 Isoelectric Point: 4.8718
ChromosomeChromosome/Scaffold: 02 Start: 47940370 End: 47945165
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17253440
  IGVNIGLDISDIPGPTEIVALLKAQSIQHVRLYDADRALLRALAKTGIRVTVSVPNDQLLGIGQSNATAANWVTRNVIAHIPSTNITAICVGSEVLTTLP
  NAAPILVSAINFIHSALVAANLDQQIKVSSPHSSSIILDSFPPSQAFFNRTWNPVMVPMLKFLQSTGSYLMLNVYPYYDYQQANDAIPLDYALFRPLPPN
  KEAVDSNTLLHYTNVFDAVVDAAYFAMLDLNFTNIPIMVTESGWPSKGDSSEPDATVDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNEDLRSG
  PFSEKNWGLFYANGEPVYTL
Full Sequence
Protein Sequence     Length: 353     Download
MALLLLLFFM LPLSISASGS GDAFIGVNIG LDISDIPGPT EIVALLKAQS IQHVRLYDAD    60
RALLRALAKT GIRVTVSVPN DQLLGIGQSN ATAANWVTRN VIAHIPSTNI TAICVGSEVL    120
TTLPNAAPIL VSAINFIHSA LVAANLDQQI KVSSPHSSSI ILDSFPPSQA FFNRTWNPVM    180
VPMLKFLQST GSYLMLNVYP YYDYQQANDA IPLDYALFRP LPPNKEAVDS NTLLHYTNVF    240
DAVVDAAYFA MLDLNFTNIP IMVTESGWPS KGDSSEPDAT VDNANTYNSN LIRHVLNNTG    300
TPKHPGIAVS TYIYELYNED LRSGPFSEKN WGLFYANGEP VYTLHLTGAG ST*           360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53096.0e-725733784+
pfam00332Glyco_hydro_173.0e-6425344320+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26850.102235120349unnamed protein product [Vitis vinifera]
EMBLCBI33479.102235019347unnamed protein product [Vitis vinifera]
RefSeqXP_002312452.10223511330predicted protein [Populus trichocarpa]
RefSeqXP_002314794.1033512344predicted protein [Populus trichocarpa]
RefSeqXP_002527772.1013511349Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0253461312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur8_B0253473315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur8_A0253473315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur7_B0253473315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A0253473315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Signal Peptide
Cleavage Site
17
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR951683281703500
EX302541310203290
HS258579257823380
HS013357257823380
GT127878285183020
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_091_00065.2.25.344Aquca_091_00065.1.25.344Aquca_004_00728.2.30.350Aquca_004_00728.1.30.350Aquca_005_00012.3.49.368
Aquca_005_00012.2.49.368Aquca_005_00012.1.49.368Aquca_009_00463.1.26.346
Arabidopsis lyrata918818.26.346894267.29.348484077.23.342879428.44.363478745.26.346
913572.27.345
Arabidopsis thalianaAT5G56590.1.26.346AT2G01630.2AT2G01630.1.23.342AT3G13560.3.26.346AT3G13560.2.26.346
AT3G13560.1.26.346AT1G66250.1.32.350AT1G11820.2.44.363AT1G11820.1AT4G29360.2.27.345
AT4G29360.1.27.345
Brachypodium distachyonBradi1g69610.1.25.345Bradi1g23640.1.34.355Bradi1g26510.1.46.373Bradi2g49330.2.27.344Bradi2g49330.1.27.344
Brassica rapaBra002805.12.332Bra027421.26.345Bra026644.23.342Bra039757.32.351Bra016812.48.367
Bra010330.16.334Bra011100.28.316
Carica papayaevm.model.supercontig_116.58.23.342evm.model.supercontig_2.222.14.333evm.model.supercontig_152.27.47.366
Capsella rubellaCarubv10026261m.28.348Carubv10019942m.166.485Carubv10019481m.23.342Carubv10013514m.26.346Carubv10007158m.27.345
Citrus clementinaCiclev10011549m.23.342Ciclev10014990m.24.343Ciclev10015028m.26.347Ciclev10015027m.26.347
Citrus sinensisorange1.1g010931m.23.342orange1.1g010833m.24.343orange1.1g010394m.31.350orange1.1g011132m.26.347orange1.1g011131m.26.347
Cucumis sativusCucsa.006230.1.30.349Cucsa.029930.3.23.342Cucsa.029930.1.23.342Cucsa.085740.1.42.361Cucsa.355790.4.25.345
Cucsa.355790.3.25.345Cucsa.355790.2.25.345Cucsa.355790.1.25.345Cucsa.153140.1.29.348
Eucalyptus grandisEucgr.F02860.2.27.346Eucgr.F02860.1.27.346Eucgr.G02118.1.24.343Eucgr.D01339.2.43.362Eucgr.D01339.1.43.362
Eucgr.E04042.1.55.374Eucgr.B03614.1.26.346
Fragaria vescamrna30530.1-v1.0-hybrid.32.351mrna19637.1-v1.0-hybrid.233.552
Glycine maxGlyma02g07730.1.23.342Glyma14g39510.3.75.394Glyma14g39510.2.75.394Glyma11g33650.1.23.342Glyma02g41190.1.24.343
Glyma05g34930.2.22.341Glyma18g04560.1.23.342Glyma08g04780.2.27.346Glyma16g26800.5.32.292Glyma16g26800.4.32.292
Glyma16g26800.3.32.292Glyma07g39140.5.43.362Glyma07g39140.4.43.362Glyma07g39140.3.43.362Glyma17g01601.2.66.385
Glyma17g01601.1.66.385Glyma14g16630.2.29.350Glyma17g29820.4.26.347Glyma17g29820.3.26.347Glyma17g29820.2.26.347
Glyma08g12020.1.26.347Glyma05g28870.1.26.347Glyma01g05991.1Glyma16g26800.7.33.138Glyma16g26800.7.33.138
Glyma16g26800.6.33.138Glyma16g26800.6.33.138
Gossypium raimondiiGorai.001G204900.2.125.444Gorai.001G204900.1.125.444Gorai.005G159100.2.23.342Gorai.005G159100.1.23.342Gorai.002G174100.2.23.342
Gorai.002G174100.1.23.342Gorai.004G064200.1.23.342Gorai.009G179400.3.46.365Gorai.009G179400.2.46.365Gorai.009G179400.1.46.365
Gorai.004G094500.1.25.345Gorai.010G126400.5.26.347Gorai.010G126400.2.26.347Gorai.010G126400.1.26.347
Linum usitatissimumLus10013465.24.343Lus10002295.34.354Lus10004044.34.354Lus10031456.44.370Lus10039179.46.365
Lus10034987.31.294
Malus domesticaMDP0000251002.284.604MDP0000271262.26.346MDP0000319911.279.599MDP0000120761.26.346
Manihot esculentacassava4.1_005970m.32.351cassava4.1_006180m.23.342cassava4.1_021465m.50.369cassava4.1_030523m.24.341cassava4.1_006189m.26.346
Medicago truncatulaMedtr5g078200.1.23.342Medtr3g065460.1.24.344Medtr4g132280.1.45.364Medtr8g085720.1.26.346Medtr3g083580.1.26.348
Medtr8g102340.1.54.312Medtr6g090590.1.61.310
Mimulus guttatusmgv1a004953m.31.350mgv1a005128m.23.342mgv1a006342m.31.350mgv1a004989m.25.345mgv1a005031m.28.346
Oryza sativaLOC_Os03g12140.1.26.346LOC_Os07g38930.5.31.352LOC_Os07g38930.4.31.352LOC_Os07g38930.3.31.352LOC_Os07g38930.2.31.352
LOC_Os07g38930.1.31.352LOC_Os07g32600.2.45.374LOC_Os07g32600.1.45.374LOC_Os01g53750.1.23.341
Panicum virgatumPavirv00023750m.26.346Pavirv00010764m.25.346Pavirv00062581m.25.346Pavirv00014937m.41.373Pavirv00068281m.41.373
Pavirv00025012mPavirv00058553m.13.331
Physcomitrella patensPp1s98_31V6.1.28.346Pp1s1_72V6.2.26.344Pp1s1_72V6.1.26.344Pp1s138_47V6.2.38.358Pp1s138_47V6.1.38.358
Pp1s85_128V6.1.32.350
Phaseolus vulgarisPhvul.001G230000.1.23.343Phvul.004G077000.1.22.341Phvul.008G236700.1.23.342Phvul.002G319500.1.25.344Phvul.003G079900.1.44.363
Phvul.001G056400.1.29.350Phvul.002G236300.2.26.347Phvul.002G236300.1.26.347Phvul.006G149100.2.35.354Phvul.006G149100.1.35.354
Picea abiesMA_10436589g0010.77.396MA_9241891g0010.84.403
Populus trichocarpaPotri.004G086400.3.17.336Potri.004G086400.1.31.350Potri.017G130200.2.31.350Potri.017G130200.1.31.350Potri.010G108500.1.23.342
Potri.008G133200.1.23.342Potri.004G010500.2.45.364Potri.004G010500.1.45.364Potri.011G006100.1.45.364Potri.003G218500.4.22.341
Potri.003G218500.3Potri.003G218500.2.22.341Potri.003G218500.1.22.341Potri.001G006500.2.22.341Potri.001G006500.1.22.341
Potri.018G068600.2Potri.018G068600.1.27.345
Prunus persicappa004534m.31.350ppa003984m.52.371ppa004732m.26.346
Ricinus communis29692.m000518.23.34229005.m000260.34.35329842.m003579.50.369
Setaria italicaSi029628m.25.346Si029448m.39.370Si000583m.196.514Si000582m.196.514
Selaginella moellendorffii442025.18.33675479.10.330402967.20.337
Sorghum bicolorSb01g042560.1.26.346Sb02g037380.1.25.346Sb03g034100.1.27.345
Thellungiella halophilaThhalv10013309m.26.346Thhalv10020572m.23.342Thhalv10020571m.23.342Thhalv10020570m.23.342Thhalv10004013m.39.358
Thhalv10018427m.35.354Thhalv10006713m.49.368Thhalv10024870m.27.345
Vitis viniferaGSVIVT01030716001.22.341GSVIVT01011682001.23.342GSVIVT01012711001.47.366GSVIVT01015282001.26.343
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)