y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G026900.1
FamilyGT19
Protein PropertiesLength: 481 Molecular Weight: 53876.9 Isoelectric Point: 9.7196
ChromosomeChromosome/Scaffold: 03 Start: 2430637 End: 2435238
Descriptiontransferases, transferring glycosyl groups
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT19564340
  VFLVAGEVSGDSIASRLMASLKLFSPFPLRFAGVGGAKMASEGLQSQFSMEDISVMGLWELLPHLYRIRVKLKETVQAAVLFEPHVVLTVDSKGFSFRFL
  KQLRARYSQKKLDFPSHFHYVAPSFWAWKGGEARLRGLAEFVDHLLCILPNEDKICRLNGLYATAVGHPVLEDVLELNLRNNSSIHEWRAEGNAEDFRNK
  YAVPAGATVISLLPGSRVQEVRRMLPIFSDTLELMKDSVPQLMTVIHVAPNEHVENFIAGAIHRWPVPVILIPGGTTQLRYDAFSASRVALCTSGTVAVE
  LQLARLPCVVAYRAHILTEWYVRYKAKIQYISLPNILLDKAIIPEALFQSCKPAKLALLLNDLIHDNGCREEQVIAAQK
Full Sequence
Protein Sequence     Length: 481     Download
MMLSNWIPPI SLGARTLFRR KWNPNPIPKI VTLQWFSFSS SKAPIDMAAR DGELRVFLVA    60
GEVSGDSIAS RLMASLKLFS PFPLRFAGVG GAKMASEGLQ SQFSMEDISV MGLWELLPHL    120
YRIRVKLKET VQAAVLFEPH VVLTVDSKGF SFRFLKQLRA RYSQKKLDFP SHFHYVAPSF    180
WAWKGGEARL RGLAEFVDHL LCILPNEDKI CRLNGLYATA VGHPVLEDVL ELNLRNNSSI    240
HEWRAEGNAE DFRNKYAVPA GATVISLLPG SRVQEVRRML PIFSDTLELM KDSVPQLMTV    300
IHVAPNEHVE NFIAGAIHRW PVPVILIPGG TTQLRYDAFS ASRVALCTSG TVAVELQLAR    360
LPCVVAYRAH ILTEWYVRYK AKIQYISLPN ILLDKAIIPE ALFQSCKPAK LALLLNDLIH    420
DNGCREEQVI AAQKFVKLIL PSERIKHNLP QQNLKSYADY TPSAIAAWTI LNHGRPVTSI    480
*                                                                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK01021lpxB5.0e-3457439396+
TIGR00215lpxB9.0e-5256418369+
pfam02684LpxB8.0e-7256447393+
PRK00025lpxB5.0e-9054428379+
COG0763LpxB2.0e-9654450400+
Gene Ontology
GO TermDescription
GO:0008915lipid-A-disaccharide synthase activity
GO:0009245lipid A biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI28885.10474761431unnamed protein product [Vitis vinifera]
GenBankEEC71491.104547735472hypothetical protein OsI_03760 [Oryza sativa Indica Group]
RefSeqNP_178535.203247518454transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002458499.104547510443hypothetical protein SORBIDRAFT_03g034785 [Sorghum bicolor]
RefSeqXP_002528957.104047632469Lipid-A-disaccharide synthase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GW89340325512550
CO9817022352474810
DW017982222422630
EY717263273943660
EY717263443513940.00001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00075.3Aquca_006_00075.2Aquca_006_00075.1
Arabidopsis lyrata480096
Arabidopsis thalianaAT2G04560.1
Brachypodium distachyonBradi2g50040.1
Brassica rapaBra015155.41.173Bra015155.41.173Bra015155.191.448Bra015155.191.448
Carica papayaevm.model.supercontig_132.41
Capsella rubellaCarubv10016120m
Citrus clementinaCiclev10018214m
Citrus sinensisorange1.1g024872morange1.1g016179m
Cucumis sativusCucsa.139770.1
Eucalyptus grandisEucgr.K00731.1
Fragaria vescamrna01138.1-v1.0-hybrid
Glycine maxGlyma02g11180.1
Gossypium raimondiiGorai.001G218100.1Gorai.001G218100.5Gorai.001G218100.6Gorai.001G218100.4Gorai.001G218100.3
Gorai.001G218100.2
Linum usitatissimumLus10035357Lus10029959
Malus domesticaMDP0000254582MDP0000227552
Manihot esculentacassava4.1_026066m
Mimulus guttatusmgv1a006184m
Oryza sativaLOC_Os01g54900.1
Panicum virgatumPavirv00020712mPavirv00034263mPavirv00034264mPavirv00034262m
Physcomitrella patensPp1s51_278V6.2Pp1s51_278V6.1Pp1s51_297V6.1Pp1s98_156V6.1
Picea abiesMA_10428134g0010MA_159001g0240MA_10297492g0010
Populus trichocarpaPotri.014G160300.1
Prunus persicappa026476m
Ricinus communis56517.m00002234198.m00002229620.m000548
Selaginella moellendorffii405438
Sorghum bicolorSb03g034785.1
Thellungiella halophilaThhalv10002525m
Vitis viniferaGSVIVT01030530001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny