y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G027500.1
FamilyCBM57
Protein PropertiesLength: 638 Molecular Weight: 69391.9 Isoelectric Point: 6.5046
ChromosomeChromosome/Scaffold: 03 Start: 2486652 End: 2499807
DescriptionDi-glucose binding protein with Leucine-rich repeat domain
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572223705.8e-22
  SDPFGRSWQSDSEFRTGRSKVVAVSTRSSISGAEQKPNYFPAKLYQTAAMTATTAEEGGGVLEYELNVDAKLDYLVWLHFAEIEGRVRRVGGRVFDVYLN
  EVNLTRVDIYKQVGGFAAFTWHHTVKNLSSSVLSVKLVGVVGAPLICGI
Full Sequence
Protein Sequence     Length: 638     Download
MALFLTLSLL CIIFATTTTS TNLPHSFSFP YGLAYHIDCG SPTNTTDPFN TTWLSDRYFS    60
GGATGIVSEP LHFHHAHEKT LRFFPISSGK KNCYAIPSLP PSRYLLRTFV VYDNYDGRSH    120
PPSFDVAVGS TVVFSWRSPW PLSLARDGAY ADLFATILSS EALICFYSLA TDPPVISSIE    180
LFAADLASYD AAAIADNGTV LVNYGRLSCG SDQWGPGFSN DSDPFGRSWQ SDSEFRTGRS    240
KVVAVSTRSS ISGAEQKPNY FPAKLYQTAA MTATTAEEGG GVLEYELNVD AKLDYLVWLH    300
FAEIEGRVRR VGGRVFDVYL NEVNLTRVDI YKQVGGFAAF TWHHTVKNLS SSVLSVKLVG    360
VVGAPLICGI ENYALVPSDP STVPEQVVAM KALKDSLRVP ERMGWNGDPC APTNWDAWEG    420
VTCRMSKDNS ALVISQIDLG SQGLKGFISD QISLLSDLVS LNLSSNLLTG EIPSGLGQKS    480
LIHVDLSNNQ LTGSIPDSIA ASTSLQLVLL KGNLLEGQVP EQLYSIGVHG GAIDLSGNKG    540
LCGVPSLPAC PMFWENGKLS THGKIAIGLS CSFVFCAILL LVYIFIRRRR NDYDFALPHE    600
LTSLAAKRNR YQRQKSLMVL EMESQHAKGL PSHFTTQ*                            660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00113PLN001137.0e-746952659+
PLN00113PLN001136.0e-746952356+
PLN00113PLN001135.0e-9469591158+
pfam12819Malectin_like2.0e-4237341319+
PLN03150PLN031502.0e-9610591596+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG50525.102663721577AC084221_7 hypothetical protein [Arabidopsis thaliana]
RefSeqNP_564237.202663221622leucine-rich repeat protein-related [Arabidopsis thaliana]
RefSeqXP_002281668.102963225621PREDICTED: similar to leucine-rich repeat protein-related [Vitis vinifera]
RefSeqXP_002457393.103463029625hypothetical protein SORBIDRAFT_03g006620 [Sorghum bicolor]
RefSeqXP_002524408.103060819591serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hq1_A0.0000000238952531158A Chain A, Crystal Structure Of The Phosphoenolpyruvate-Binding Enzyme I-Domain From The Thermoanaerobacter Tengcongensis Pep: Sugar Phosphotransferase System (Pts)
PDB3rj0_A0.0000002408550608745A Chain A, Crystal Structure Of The Phosphoenolpyruvate-Binding Enzyme I-Domain From The Thermoanaerobacter Tengcongensis Pep: Sugar Phosphotransferase System (Pts)
Transmembrane Domains
StartEnd
565587
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9812052302234520
BX839191313263360
EL4836392533826330
EH7649922483646110
CO0771422773245980
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1
Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)