y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G065100.1
FamilyGT77
Protein PropertiesLength: 709 Molecular Weight: 80543.9 Isoelectric Point: 7.441
ChromosomeChromosome/Scaffold: 03 Start: 9208020 End: 9211837
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT774466660
  VENFVVCAIDQETYQFSILQGIPVFTDPTAPSNISFDDCHFGTKCFQRVTKVKSRIVLKILKLGYNVLLSDVDVYWFKNPLPLLHSFGPAVLAAQSDEYK
  TQGPINLPRRLNSGFYYAHSDTQTIAAIEKVVRHAETSGLSEQPSFYDTLCGEGGSNRVGDDKCVEPETNLTVHFLDRDLFPNGAYQELWREKNVKAACL
  KKGSYIIHNNWISGRLKKLER
Full Sequence
Protein Sequence     Length: 709     Download
MKMISQNEDR IFSLVQAMKG SQVELWSVWL SGFVFIALSL YATQRLPSLK DHSRASKDVI    60
FGITIFTAPK PFKGSTGAKQ TLAVRSWLAL SPYVTVVLYS QDPSVASFAD AFDSRVLVDT    120
NIDFTFLGTP FFHSMIAKSR SHTSEISVIV DPDTIILSGF ISTLNHVYQL DHDWLLVVSA    180
QNVSSFPFHL DKSGKHWQTG NGKRMKIQQL QKILQHNWQG KRCYTRMIMV WNSKDVPLHD    240
GVLPPFLYGK GIHNNWVIHE AMSSEFRFVF DASLTITSFY LNEEDDFSPT QGNSSALDIE    300
HRNWEYIGNS HVGANYGSFF YREANSNLVK LLKCNKRYIV VDTKKNVVYS IGHQGAINLM    360
KEKYFPPWLK ENRVYCIDSM KPQTISLDCS EKDQREIPAT PELPFSLESL LSINADKTKT    420
VILTVAGYSY KDMLMSWVCR LRELFVENFV VCAIDQETYQ FSILQGIPVF TDPTAPSNIS    480
FDDCHFGTKC FQRVTKVKSR IVLKILKLGY NVLLSDVDVY WFKNPLPLLH SFGPAVLAAQ    540
SDEYKTQGPI NLPRRLNSGF YYAHSDTQTI AAIEKVVRHA ETSGLSEQPS FYDTLCGEGG    600
SNRVGDDKCV EPETNLTVHF LDRDLFPNGA YQELWREKNV KAACLKKGSY IIHNNWISGR    660
LKKLERQVLS GLWEYDPGTR MCLWCWHGTV SDTEVNSEER VDSFLSSL*                720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans1.0e-47444667225+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN65937.101356891540hypothetical protein [Vitis vinifera]
EMBLCBI18645.10356916615unnamed protein product [Vitis vinifera]
RefSeqNP_177220.201356831537unknown protein [Arabidopsis thaliana]
RefSeqXP_002271910.101357001568PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312675.101356831550predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
2544
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL3424482544346870
EX1364523093286350
EL3544682694156830
GO9564462314616910
GO956446314464760.25
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_094_00019.1Aquca_094_00019.2Aquca_094_00019.3Aquca_094_00019.4
Arabidopsis lyrata476193
Arabidopsis thalianaAT1G70630.1
Brachypodium distachyonBradi2g19997.1
Brassica rapaBra016198
Carica papayaevm.model.supercontig_33.19
Capsella rubellaCarubv10019952mCarubv10020113m
Citrus clementinaCiclev10033870m
Citrus sinensisorange1.1g043225m
Cucumis sativusCucsa.286480.1
Eucalyptus grandisEucgr.B03287.1
Glycine maxGlyma18g20856.1Glyma08g38866.1
Gossypium raimondiiGorai.005G178600.1Gorai.005G178600.2
Linum usitatissimumLus10036860Lus10006212
Malus domesticaMDP0000300726
Manihot esculentacassava4.1_024537m
Medicago truncatulaMedtr8g069400.1
Mimulus guttatusmgv1a025056mmgv1a022943m
Oryza sativaLOC_Os05g43810.1
Panicum virgatumPavirv00043566mPavirv00008500m
Physcomitrella patensPp1s151_80V6.1Pp1s21_134V6.1
Picea abiesMA_10426353g0010
Populus trichocarpaPotri.008G186800.1
Prunus persicappa019665m
Ricinus communis27504.m000645
Selaginella moellendorffii76356
Sorghum bicolorSb09g025390.1
Thellungiella halophilaThhalv10018343m
Vitis viniferaGSVIVT01005754001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny