y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G073900.1
FamilyGH17
Protein PropertiesLength: 369 Molecular Weight: 41137.4 Isoelectric Point: 9.0289
ChromosomeChromosome/Scaffold: 03 Start: 11381953 End: 11383133
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17233460
  IGVNYGQLGNNLPSPQRSIELLTSMKAGLVKLYDANPEILRLLSTTKLKVSIMIPNNEIAGIATNQSMADEWVRNNVLPYYPKTLIRYLLVGNEVLSYNS
  EQGHQMWNDLVPAMRNIERSLKGQNIRDIKIGTPLAMDVLQSTFPPSSGTFRPDVRDSVMAPMLKFLNRTKSFFFIDIYPYFPWSQNPHNISIDFALLRG
  NSSIRDPATGLLYTNLLDQMLDSLIFAMSKLGYPNINLVVSETGWPNSGDEEELGANTFNAATYNRNLILKMSTKPPIGTPARPGVAIPTFIFSLFDENQ
  KPGSGTERHWGLLHPDGTPIYDID
Full Sequence
Protein Sequence     Length: 369     Download
MSHLVVFLLY LLWITRTKVS SNIGVNYGQL GNNLPSPQRS IELLTSMKAG LVKLYDANPE    60
ILRLLSTTKL KVSIMIPNNE IAGIATNQSM ADEWVRNNVL PYYPKTLIRY LLVGNEVLSY    120
NSEQGHQMWN DLVPAMRNIE RSLKGQNIRD IKIGTPLAMD VLQSTFPPSS GTFRPDVRDS    180
VMAPMLKFLN RTKSFFFIDI YPYFPWSQNP HNISIDFALL RGNSSIRDPA TGLLYTNLLD    240
QMLDSLIFAM SKLGYPNINL VVSETGWPNS GDEEELGANT FNAATYNRNL ILKMSTKPPI    300
GTPARPGVAI PTFIFSLFDE NQKPGSGTER HWGLLHPDGT PIYDIDLTGK HPITNPAPLP    360
 APKSQFTV*                                                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53093.0e-625733885+
pfam00332Glyco_hydro_175.0e-12023346325+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM64490.101536429378beta-1,3-glucanase, putative [Arabidopsis thaliana]
GenBankABK28569.101536429378unknown [Arabidopsis thaliana]
EMBLCAN60692.1013641364hypothetical protein [Vitis vinifera]
RefSeqXP_002298669.1053601360predicted protein [Populus trichocarpa]
RefSeqXP_002520622.10536210367Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ghs_B0233471306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0233471306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB2cyg_A0233471312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghr_A0233471306A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1aq0_B0233471306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY302831318533680
DY968818307583620
DR9441182581053610
DY829463298483390
FY430678268152820
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.45.369Aquca_009_00879.1.26.349
Arabidopsis lyrata493503.42.363479892.37.361317589.25.345
Arabidopsis thalianaAT4G14080.1.42.363AT3G23770.1.37.361AT3G07320.1.26.346
Brachypodium distachyonBradi4g34390.1.35.358Bradi3g40907.1.44.364Bradi5g12137.1.31.354
Brassica rapaBra001918.41.365Bra028343.37.360Bra029639.25.345Bra014979.39.363Bra001245.25.345
Bra032758.43.365Bra037057.43.364Bra038969.43.364
Carica papayaevm.model.supercontig_157.32.29.353evm.model.supercontig_8.110.24.345
Capsella rubellaCarubv10015952m.37.361Carubv10006945m.42.363Carubv10013655m.25.345
Citrus clementinaCiclev10004917m.28.352Ciclev10031440m.27.350
Citrus sinensisorange1.1g012660m.28.352orange1.1g038099m
Cucumis sativusCucsa.251950.1.28.351Cucsa.149990.1.26.347
Eucalyptus grandisEucgr.K02113.2.27.350Eucgr.K02113.1.27.350Eucgr.K02112.1
Fragaria vescamrna06587.1-v1.0-hybridmrna17437.1-v1.0-hybrid.135.456mrna17436.1-v1.0-hybrid.101.320mrna17436.1-v1.0-hybrid.101.320
Glycine maxGlyma13g24190.1Glyma08g46110.1.30.351Glyma18g32840.1.30.351
Gossypium raimondiiGorai.001G230200.2.24.345Gorai.001G230200.1.24.345Gorai.005G026800.1.26.346Gorai.N004800.1.27.348Gorai.006G224700.1.23.346
Linum usitatissimumLus10038211.25.346Lus10008881.29.352Lus10025892.18.281
Malus domesticaMDP0000317729.26.347MDP0000235663.26.347MDP0000283768.23.310
Manihot esculentacassava4.1_024973m.11.334cassava4.1_007070m.27.348cassava4.1_023781m.26.347
Medicago truncatulaMedtr8g012400.1.30.350
Mimulus guttatusmgv1a005896m.30.346mgv1a006049m.29.349mgv1a006924mmgv1a005774m.34.356
Oryza sativaLOC_Os08g41410.1.33.357LOC_Os09g32550.2.31.357LOC_Os09g32550.1.34.360LOC_Os03g62860.1.27.354
Panicum virgatumPavirv00008164m.48.370Pavirv00066351m.38.362Pavirv00059046m.35.359Pavirv00006057m.24.347Pavirv00044843m.143.335
Pavirv00044843m.143.335
Physcomitrella patensPp1s280_49V6.1Pp1s284_2V6.1Pp1s270_88V6.4.56.376Pp1s270_88V6.3.76.396Pp1s270_88V6.2.76.396
Pp1s270_88V6.1.56.376Pp1s218_3V6.2.53.373Pp1s218_3V6.1.53.373Pp1s70_290V6.1Pp1s268_55V6.2
Pp1s40_200V6.1Pp1s190_47V6.1Pp1s268_55V6.1Pp1s7_53V6.2Pp1s7_53V6.1
Pp1s145_119V6.1Pp1s197_147V6.1Pp1s312_32V6.1.39.359Pp1s53_51V6.2Pp1s53_51V6.1
Pp1s26_167V6.1
Phaseolus vulgarisPhvul.010G023800.1.27.348Phvul.008G142200.1.29.349
Picea abiesMA_17470g0010.39.361MA_7353g0010.32.349MA_90526g0010.38.336
Populus trichocarpaPotri.017G060300.1.27.350Potri.002G247900.2.27.348Potri.002G247900.1.27.348Potri.002G247800.1.27.348
Ricinus communis30157.m000802
Setaria italicaSi015679m.50.372Si029669m.38.362
Selaginella moellendorffii156981437767.30.349230318413735.93.40982448
66564
Sorghum bicolorSb07g026540.1.48.370Sb02g029080.1.37.361Sb01g001430.1.38.362
Thellungiella halophilaThhalv10025081m.43.364Thhalv10002513m.35.359Thhalv10020663m.34.354Thhalv10020660m.34.354
Vitis viniferaGSVIVT01031698001.29.351GSVIVT01031619001.25.211
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)