y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G075400.1
FamilyGH116
Protein PropertiesLength: 937 Molecular Weight: 105506 Isoelectric Point: 5.9393
ChromosomeChromosome/Scaffold: 03 Start: 11670041 End: 11681901
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165148750
  GQFLYLEGIEYKMWNTYDVHFYASFSLVMLFPKLELSIQRDFAAAVLMHDPSKMKLLFNGQWAPRKVLGAVPHDIGLNDPWFEVNGYNLYNTDRWKDLNP
  KFVLQIYRDVVVTGDKKFAQAVWPAVYIAIAYMDQFDKNGDGMIENEGFPDQTYDTWSVSGVSAYSGGLWVAALQAASALAHEVGDKGSEDYFWLKFQKA
  KAVYEKLWNGSYFNYDSSGGSSSSSIQADQLAGQWYARACGLSPIVEEKKSRSALQMVYDYNVMKVEDGRRGAVNGMLPDGKIDMSTMQSREIWSGVTYA
  LAATMIQQNMIDMAFQTAGGVYETAWSDNGLGYSFQTPEAWTTKDEYRSLCYMRPLAIWAMQ
Full Sequence
Protein Sequence     Length: 937     Download
MEDHKSSNSK VHPSNLPALT WHRKLNSHGN ASSEISLCLK EIVHLAPIGY RLWRHCREEA    60
AKGRIGVIDP FAKRSVTFCH GVPLGGIGAG SIGRSFRGEF QRWQLFPVIC EEKPVLANQF    120
SVFVSRPSGE KYCSVLCPGK QEIIKQNPVS GIESWDWNIN GNSSTYHALY PRAWTIYEEP    180
DPALRITCHQ ISPVIPHNYK ESSFPVTVFT FTLKNLGKTT ADVTLLFTWT NSVGGISEFT    240
GNHFNSKKML NDGVHAVLLH HKTANERSPV TFAIAAEETE YVHISECPVF VVSGSYNGIS    300
AKDMWHEVKQ HGSFDHLNFA ETATPSEPGS SIGAAIAATV TVPPDAERIV TFSLAWDCPE    360
VKFPEGRTYY RRYTKFYGTH GDAAADIAHD AIIEHCQWET QIDDWQRPIL EDKRLPEWYP    420
TTLLNELYYL NSGGTIWTDG SLPVNSLVNT GERKFSLDGL ISRLENTNNL SHQNDTAINI    480
LEMFASVAEQ AHSPPASKSA YGVNLLQEGE ENIGQFLYLE GIEYKMWNTY DVHFYASFSL    540
VMLFPKLELS IQRDFAAAVL MHDPSKMKLL FNGQWAPRKV LGAVPHDIGL NDPWFEVNGY    600
NLYNTDRWKD LNPKFVLQIY RDVVVTGDKK FAQAVWPAVY IAIAYMDQFD KNGDGMIENE    660
GFPDQTYDTW SVSGVSAYSG GLWVAALQAA SALAHEVGDK GSEDYFWLKF QKAKAVYEKL    720
WNGSYFNYDS SGGSSSSSIQ ADQLAGQWYA RACGLSPIVE EKKSRSALQM VYDYNVMKVE    780
DGRRGAVNGM LPDGKIDMST MQSREIWSGV TYALAATMIQ QNMIDMAFQT AGGVYETAWS    840
DNGLGYSFQT PEAWTTKDEY RSLCYMRPLA IWAMQWELSR TKHPQYECIL DMKEEDIMSR    900
YHDGFSKVAR LLKVKEETDC TSLFQLIYDF TCKRMC*                             960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43541.0e-3080439372+
pfam12215GBA2_N7.0e-5981381309+
COG4354COG43544.0e-68513874381+
pfam04685DUF6085.0e-161514876367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAE99037.10693518955hypothetical protein [Arabidopsis thaliana]
DDBJBAH19567.10693518955AT5G49900 [Arabidopsis thaliana]
RefSeqNP_199801.20693518955catalytic/ glucosylceramidase [Arabidopsis thaliana]
RefSeqXP_002264575.101093522947PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002528846.10293513949conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG7030273285328590
DY2920403735278960
JG7040912995618590
JG7051212985628590
FC9176483055278310
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)